Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 88438..88708 | Replicon | plasmid pGD31-F1928 |
| Accession | NZ_CP031295 | ||
| Organism | Escherichia coli strain EC17GD31 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | DWB25_RS25230 | Protein ID | WP_001312861.1 |
| Coordinates | 88550..88708 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 88438..88501 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DWB25_RS25205 | 84213..84752 | + | 540 | WP_032332913.1 | single-stranded DNA-binding protein | - |
| DWB25_RS25210 | 84809..85042 | + | 234 | WP_000005987.1 | DUF905 family protein | - |
| DWB25_RS25215 | 85107..87065 | + | 1959 | WP_039000998.1 | ParB/RepB/Spo0J family partition protein | - |
| DWB25_RS25220 | 87120..87554 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| DWB25_RS25225 | 87551..88270 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| DWB25_RS27915 | 88282..88470 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 88282..88506 | + | 225 | NuclAT_0 | - | - |
| - | 88282..88506 | + | 225 | NuclAT_0 | - | - |
| - | 88282..88506 | + | 225 | NuclAT_0 | - | - |
| - | 88282..88506 | + | 225 | NuclAT_0 | - | - |
| - | 88438..88501 | - | 64 | - | - | Antitoxin |
| DWB25_RS25230 | 88550..88708 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| DWB25_RS25245 | 89629..89916 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| DWB25_RS25250 | 90034..90855 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
| DWB25_RS25255 | 91152..91754 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| DWB25_RS25260 | 92075..92458 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| DWB25_RS25265 | 92645..93334 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul3 / sul2 / floR / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / tet(M) / tet(A) / aph(3')-Ia / sitABCD / blaTEM-1B | iucA / iucB / iucC / iucD / iutA | 1..245305 | 245305 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T108863 WP_001312861.1 NZ_CP031295:88550-88708 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T108863 NZ_CP031295:88550-88708 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT108863 NZ_CP031295:c88501-88438 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|