Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2685887..2686048 | Replicon | chromosome |
| Accession | NZ_CP031275 | ||
| Organism | Staphylococcus xylosus strain | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | DWB98_RS12720 | Protein ID | WP_002441941.1 |
| Coordinates | 2685953..2686048 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2685887..2685924 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DWB98_RS12685 | 2680908..2681372 | + | 465 | WP_042363441.1 | hypothetical protein | - |
| DWB98_RS12690 | 2681572..2681880 | - | 309 | WP_107543257.1 | hypothetical protein | - |
| DWB98_RS12695 | 2682043..2682735 | + | 693 | WP_171031833.1 | hypothetical protein | - |
| DWB98_RS12700 | 2682921..2683007 | - | 87 | WP_107539440.1 | type I toxin-antitoxin system Fst family toxin | - |
| DWB98_RS12705 | 2683343..2684305 | - | 963 | WP_042363443.1 | nitronate monooxygenase | - |
| DWB98_RS12710 | 2684430..2684801 | + | 372 | WP_042363444.1 | helix-turn-helix transcriptional regulator | - |
| DWB98_RS12715 | 2684975..2685700 | + | 726 | WP_042363445.1 | NAD(P)-binding domain-containing protein | - |
| - | 2685887..2685924 | + | 38 | - | - | Antitoxin |
| DWB98_RS12720 | 2685953..2686048 | - | 96 | WP_002441941.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| DWB98_RS12725 | 2686183..2687356 | - | 1174 | Protein_2461 | ABC transporter permease | - |
| DWB98_RS12730 | 2687353..2688033 | - | 681 | WP_069809817.1 | ABC transporter ATP-binding protein | - |
| DWB98_RS12735 | 2688030..2689145 | - | 1116 | WP_107542877.1 | RND transporter | - |
| DWB98_RS12740 | 2689566..2690939 | + | 1374 | WP_186433724.1 | YfcC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3560.34 Da Isoelectric Point: 9.9256
>T108820 WP_002441941.1 NZ_CP031275:c2686048-2685953 [Staphylococcus xylosus]
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
Download Length: 96 bp
>T108820 NZ_CP031275:c2686048-2685953 [Staphylococcus xylosus]
ATGCTTATGATCTTCGTTCACATCATTGCACCAGTCATTAGTGGCTGTGCAGTTGCGTACTTTACTTACTGGCTTAGTAG
TAAACGCAATAAATAG
ATGCTTATGATCTTCGTTCACATCATTGCACCAGTCATTAGTGGCTGTGCAGTTGCGTACTTTACTTACTGGCTTAGTAG
TAAACGCAATAAATAG
Antitoxin
Download Length: 38 bp
>AT108820 NZ_CP031275:2685887-2685924 [Staphylococcus xylosus]
TATGCACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
TATGCACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|