Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2422651..2422835 | Replicon | chromosome |
Accession | NZ_CP031265 | ||
Organism | Staphylococcus aureus strain 13 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | DWB87_RS12355 | Protein ID | WP_000482647.1 |
Coordinates | 2422728..2422835 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2422651..2422711 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DWB87_RS12340 | 2418125..2418292 | - | 168 | WP_001790576.1 | hypothetical protein | - |
DWB87_RS12345 | 2418523..2420256 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
DWB87_RS12350 | 2420281..2422044 | - | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein/permease | - |
- | 2422651..2422711 | + | 61 | - | - | Antitoxin |
DWB87_RS12355 | 2422728..2422835 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
DWB87_RS12360 | 2422969..2423355 | - | 387 | WP_000779360.1 | flippase GtxA | - |
DWB87_RS12365 | 2423613..2424755 | + | 1143 | WP_060552761.1 | glycerate kinase | - |
DWB87_RS12370 | 2424815..2425474 | + | 660 | WP_000831301.1 | membrane protein | - |
DWB87_RS12375 | 2425656..2426867 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
DWB87_RS12380 | 2426990..2427463 | - | 474 | WP_000456497.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T108802 WP_000482647.1 NZ_CP031265:c2422835-2422728 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T108802 NZ_CP031265:c2422835-2422728 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT108802 NZ_CP031265:2422651-2422711 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|