Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3776842..3777064 | Replicon | chromosome |
| Accession | NZ_CP031215 | ||
| Organism | Escherichia coli strain Es_ST80_L1_NDM_10_2017 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | DV870_RS19405 | Protein ID | WP_001295224.1 |
| Coordinates | 3776957..3777064 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3776842..3776900 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DV870_RS19375 | 3772283..3773185 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| DV870_RS19380 | 3773196..3774179 | + | 984 | WP_021531678.1 | dipeptide ABC transporter ATP-binding protein | - |
| DV870_RS19385 | 3774176..3775180 | + | 1005 | WP_000103570.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| DV870_RS19390 | 3775210..3776481 | - | 1272 | WP_014640225.1 | amino acid permease | - |
| - | 3776842..3776900 | - | 59 | - | - | Antitoxin |
| DV870_RS19405 | 3776957..3777064 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| DV870_RS19410 | 3777151..3778830 | - | 1680 | WP_000191567.1 | cellulose biosynthesis protein BcsG | - |
| DV870_RS19415 | 3778827..3779018 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| DV870_RS19420 | 3779015..3780586 | - | 1572 | WP_074042579.1 | cellulose biosynthesis protein BcsE | - |
| DV870_RS19425 | 3780859..3781047 | + | 189 | WP_001063314.1 | YhjR family protein | - |
| DV870_RS19430 | 3781059..3781811 | + | 753 | WP_000279525.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T108620 WP_001295224.1 NZ_CP031215:3776957-3777064 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T108620 NZ_CP031215:3776957-3777064 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT108620 NZ_CP031215:c3776900-3776842 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|