Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2187976..2188192 | Replicon | chromosome |
Accession | NZ_CP031131 | ||
Organism | Staphylococcus aureus strain E16SA093 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DU470_RS11350 | Protein ID | WP_001802298.1 |
Coordinates | 2188088..2188192 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2187976..2188031 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DU470_RS11330 | 2184179..2184844 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
DU470_RS11335 | 2184996..2185316 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
DU470_RS11340 | 2185318..2186298 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
DU470_RS11345 | 2186564..2187655 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
- | 2187976..2188031 | + | 56 | - | - | Antitoxin |
DU470_RS11350 | 2188088..2188192 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
DU470_RS14505 | 2188709..2188879 | + | 171 | WP_001792292.1 | transposase | - |
DU470_RS11360 | 2188872..2189030 | + | 159 | WP_001792784.1 | hypothetical protein | - |
DU470_RS11370 | 2189688..2190545 | - | 858 | WP_000370928.1 | Cof-type HAD-IIB family hydrolase | - |
DU470_RS11375 | 2190613..2191395 | - | 783 | WP_000908189.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T108527 WP_001802298.1 NZ_CP031131:c2188192-2188088 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T108527 NZ_CP031131:c2188192-2188088 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT108527 NZ_CP031131:2187976-2188031 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|