Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2173340..2173556 | Replicon | chromosome |
Accession | NZ_CP031130 | ||
Organism | Staphylococcus aureus strain F17SA003 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DU471_RS11300 | Protein ID | WP_001802298.1 |
Coordinates | 2173452..2173556 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2173340..2173395 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DU471_RS11280 | 2169543..2170208 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
DU471_RS11285 | 2170360..2170680 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
DU471_RS11290 | 2170682..2171662 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
DU471_RS11295 | 2171928..2173019 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
- | 2173340..2173395 | + | 56 | - | - | Antitoxin |
DU471_RS11300 | 2173452..2173556 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
DU471_RS11310 | 2174236..2174394 | + | 159 | WP_001792784.1 | hypothetical protein | - |
DU471_RS11320 | 2175052..2175909 | - | 858 | WP_000370928.1 | Cof-type HAD-IIB family hydrolase | - |
DU471_RS11325 | 2175977..2176759 | - | 783 | WP_000908189.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T108513 WP_001802298.1 NZ_CP031130:c2173556-2173452 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T108513 NZ_CP031130:c2173556-2173452 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT108513 NZ_CP031130:2173340-2173395 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|