Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF4/- |
Location | 2000413..2000712 | Replicon | chromosome |
Accession | NZ_CP031130 | ||
Organism | Staphylococcus aureus strain F17SA003 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DU471_RS10310 | Protein ID | WP_011447039.1 |
Coordinates | 2000536..2000712 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2000413..2000468 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DU471_RS10265 | 1995755..1996015 | + | 261 | WP_001791826.1 | hypothetical protein | - |
DU471_RS10270 | 1996068..1996408 | - | 341 | Protein_1893 | complement inhibitor SCIN-A | - |
DU471_RS10275 | 1997092..1997541 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
DU471_RS10280 | 1997636..1997971 | - | 336 | Protein_1895 | SH3 domain-containing protein | - |
DU471_RS10290 | 1998621..1999112 | - | 492 | WP_000919350.1 | staphylokinase | - |
DU471_RS10295 | 1999303..2000058 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DU471_RS10300 | 2000070..2000324 | - | 255 | WP_000611512.1 | phage holin | - |
DU471_RS10305 | 2000376..2000483 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2000405..2000544 | + | 140 | NuclAT_0 | - | - |
- | 2000405..2000544 | + | 140 | NuclAT_0 | - | - |
- | 2000405..2000544 | + | 140 | NuclAT_0 | - | - |
- | 2000405..2000544 | + | 140 | NuclAT_0 | - | - |
- | 2000413..2000468 | + | 56 | - | - | Antitoxin |
DU471_RS10310 | 2000536..2000712 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
DU471_RS10315 | 2000862..2001158 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DU471_RS10320 | 2001216..2001503 | - | 288 | WP_001040261.1 | hypothetical protein | - |
DU471_RS10325 | 2001550..2001702 | - | 153 | WP_001153681.1 | hypothetical protein | - |
DU471_RS10330 | 2001692..2005477 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / scn / chp / sak / hlb / groEL | 1996068..2048277 | 52209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T108509 WP_011447039.1 NZ_CP031130:c2000712-2000536 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T108509 NZ_CP031130:c2000712-2000536 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT108509 NZ_CP031130:2000413-2000468 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|