Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1836109..1836289 | Replicon | chromosome |
| Accession | NZ_CP031130 | ||
| Organism | Staphylococcus aureus strain F17SA003 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | DU471_RS09225 | Protein ID | WP_001801861.1 |
| Coordinates | 1836109..1836204 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1836232..1836289 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DU471_RS09180 | 1831151..1831777 | + | 627 | WP_000669021.1 | hypothetical protein | - |
| DU471_RS09185 | 1831818..1832159 | + | 342 | WP_000627547.1 | DUF3969 family protein | - |
| DU471_RS09190 | 1832260..1832832 | + | 573 | WP_000414206.1 | hypothetical protein | - |
| DU471_RS09195 | 1833030..1833587 | - | 558 | WP_000864139.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DU471_RS09205 | 1833958..1834134 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| DU471_RS09210 | 1834145..1834528 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| DU471_RS09215 | 1835213..1835659 | - | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
| DU471_RS09225 | 1836109..1836204 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1836232..1836289 | - | 58 | - | - | Antitoxin |
| DU471_RS09230 | 1836327..1836428 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| DU471_RS09235 | 1836406..1836588 | - | 183 | Protein_1736 | transposase | - |
| DU471_RS09240 | 1836776..1837150 | - | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
| DU471_RS09245 | 1837172..1837519 | - | 348 | WP_001566695.1 | DUF1433 domain-containing protein | - |
| DU471_RS09250 | 1837756..1838172 | - | 417 | WP_020978241.1 | DUF1433 domain-containing protein | - |
| DU471_RS09255 | 1838819..1839937 | - | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 1810294..1863440 | 53146 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T108505 WP_001801861.1 NZ_CP031130:1836109-1836204 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T108505 NZ_CP031130:1836109-1836204 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT108505 NZ_CP031130:c1836289-1836232 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|