Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 82195..82459 | Replicon | plasmid pAMSC6 |
Accession | NZ_CP031111 | ||
Organism | Escherichia coli strain AMSCJX02 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | DUT84_RS28225 | Protein ID | WP_001331364.1 |
Coordinates | 82307..82459 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 82195..82252 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DUT84_RS28210 | 78533..79603 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
DUT84_RS28215 | 79622..80830 | - | 1209 | WP_001383960.1 | IncI1-type conjugal transfer protein TrbA | - |
DUT84_RS28220 | 81048..82034 | - | 987 | WP_001257838.1 | hypothetical protein | - |
- | 82195..82252 | - | 58 | NuclAT_0 | - | Antitoxin |
- | 82195..82252 | - | 58 | NuclAT_0 | - | Antitoxin |
- | 82195..82252 | - | 58 | NuclAT_0 | - | Antitoxin |
- | 82195..82252 | - | 58 | NuclAT_0 | - | Antitoxin |
DUT84_RS28225 | 82307..82459 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
DUT84_RS28230 | 82531..82782 | - | 252 | WP_001291964.1 | hypothetical protein | - |
DUT84_RS28900 | 83441..83617 | - | 177 | WP_001054900.1 | hypothetical protein | - |
DUT84_RS28235 | 83949..84158 | + | 210 | WP_000062602.1 | HEAT repeat domain-containing protein | - |
DUT84_RS28240 | 84230..84892 | - | 663 | WP_000644792.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
DUT84_RS28245 | 84957..87125 | - | 2169 | WP_077250315.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..95328 | 95328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T108477 WP_001331364.1 NZ_CP031111:82307-82459 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T108477 NZ_CP031111:82307-82459 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 58 bp
>AT108477 NZ_CP031111:c82252-82195 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|