Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 17897..18151 | Replicon | plasmid pAMSC2 |
| Accession | NZ_CP031107 | ||
| Organism | Escherichia coli strain AMSCJX02 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | - |
| Locus tag | DUT84_RS25680 | Protein ID | WP_001351576.1 |
| Coordinates | 17897..18103 (-) | Length | 69 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 18090..18151 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DUT84_RS25625 | 13436..13783 | + | 348 | Protein_11 | IS1-like element IS1A family transposase | - |
| DUT84_RS25635 | 14223..14510 | - | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DUT84_RS25640 | 14507..14758 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| DUT84_RS25655 | 15725..16582 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| DUT84_RS25660 | 16575..17057 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| DUT84_RS25665 | 17050..17124 | - | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
| DUT84_RS25675 | 17356..17613 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| DUT84_RS25680 | 17897..18103 | - | 207 | WP_001351576.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 18090..18151 | + | 62 | NuclAT_1 | - | Antitoxin |
| - | 18090..18151 | + | 62 | NuclAT_1 | - | Antitoxin |
| - | 18090..18151 | + | 62 | NuclAT_1 | - | Antitoxin |
| - | 18090..18151 | + | 62 | NuclAT_1 | - | Antitoxin |
| DUT84_RS28800 | 18407..18481 | - | 75 | Protein_19 | endonuclease | - |
| DUT84_RS25690 | 18727..18939 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| DUT84_RS25695 | 19075..19635 | - | 561 | WP_032072881.1 | fertility inhibition protein FinO | - |
| DUT84_RS25700 | 19738..20598 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| DUT84_RS25705 | 20657..21403 | - | 747 | WP_114455236.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..203856 | 203856 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7826.31 Da Isoelectric Point: 8.8807
>T108462 WP_001351576.1 NZ_CP031107:c18103-17897 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
>T108462 NZ_CP031107:c18103-17897 [Escherichia coli]
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCTGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCTGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT108462 NZ_CP031107:18090-18151 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|