Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 14140..14354 | Replicon | plasmid pDEF-2 |
Accession | NZ_CP031029 | ||
Organism | Enterococcus faecalis strain TY1 isolate flatfish |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | DTO64_RS16560 | Protein ID | WP_107164701.1 |
Coordinates | 14140..14250 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 14290..14354 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DTO64_RS16540 | 9471..12458 | + | 2988 | WP_000343406.1 | Tn3 family transposase | - |
DTO64_RS16545 | 12622..13542 | + | 921 | Protein_14 | excinuclease ABC subunit A | - |
DTO64_RS16550 | 13539..13889 | + | 351 | WP_002365943.1 | hypothetical protein | - |
DTO64_RS16560 | 14140..14250 | + | 111 | WP_107164701.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 14290..14354 | - | 65 | - | - | Antitoxin |
- | 14290..14392 | - | 103 | NuclAT_0 | - | - |
- | 14290..14392 | - | 103 | NuclAT_0 | - | - |
- | 14290..14392 | - | 103 | NuclAT_0 | - | - |
- | 14290..14392 | - | 103 | NuclAT_0 | - | - |
DTO64_RS16565 | 14589..15050 | + | 462 | WP_002365946.1 | hypothetical protein | - |
DTO64_RS17025 | 15221..15511 | + | 291 | WP_002365947.1 | hypothetical protein | - |
DTO64_RS16575 | 15615..15986 | - | 372 | WP_000049959.1 | replication-associated protein RepC | - |
DTO64_RS16580 | 15979..16824 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
DTO64_RS16590 | 17296..18306 | + | 1011 | WP_002365949.1 | replication initiator protein A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(6')-aph(2'') | asa1 | 1..58791 | 58791 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4090.89 Da Isoelectric Point: 4.1672
>T108344 WP_107164701.1 NZ_CP031029:14140-14250 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
Download Length: 111 bp
>T108344 NZ_CP031029:14140-14250 [Enterococcus faecalis]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCAATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAGCCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCAATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAGCCGAAAGTAA
Antitoxin
Download Length: 65 bp
>AT108344 NZ_CP031029:c14354-14290 [Enterococcus faecalis]
AACGACATTAAATCGTACAGATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAGATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|