Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-RNAII/- |
Location | 2946499..2946750 | Replicon | chromosome |
Accession | NZ_CP031027 | ||
Organism | Enterococcus faecalis strain TY1 isolate flatfish |
Toxin (Protein)
Gene name | txpA | Uniprot ID | S4BWW4 |
Locus tag | DTO64_RS15355 | Protein ID | WP_002404776.1 |
Coordinates | 2946499..2946621 (+) | Length | 41 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2946687..2946750 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DTO64_RS15330 | 2942130..2942762 | - | 633 | WP_002358972.1 | RloB family protein | - |
DTO64_RS15335 | 2942771..2944066 | - | 1296 | WP_002396787.1 | AAA family ATPase | - |
DTO64_RS15350 | 2944528..2946144 | + | 1617 | WP_002358967.1 | phosphatase PAP2/LCP family protein | - |
DTO64_RS15355 | 2946499..2946621 | + | 123 | WP_002404776.1 | putative holin-like toxin | Toxin |
- | 2946687..2946750 | - | 64 | - | - | Antitoxin |
DTO64_RS15360 | 2946807..2947004 | + | 198 | WP_002358966.1 | putative holin-like toxin | - |
DTO64_RS15365 | 2947123..2947263 | + | 141 | WP_077143780.1 | putative holin-like toxin | - |
DTO64_RS15370 | 2947494..2947637 | + | 144 | WP_002396786.1 | putative holin-like toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 41 a.a. Molecular weight: 4396.44 Da Isoelectric Point: 10.2826
>T108319 WP_002404776.1 NZ_CP031027:2946499-2946621 [Enterococcus faecalis]
MKGVGLLSAYETIQTILGFGMFTIALIALIVKLLKEDKKK
MKGVGLLSAYETIQTILGFGMFTIALIALIVKLLKEDKKK
Download Length: 123 bp
>T108319 NZ_CP031027:2946499-2946621 [Enterococcus faecalis]
ATGAAAGGAGTAGGCCTTTTGTCAGCATATGAGACAATTCAGACGATCCTAGGGTTTGGTATGTTTACCATTGCTTTGAT
TGCACTGATTGTGAAATTGCTTAAAGAAGACAAAAAGAAATGA
ATGAAAGGAGTAGGCCTTTTGTCAGCATATGAGACAATTCAGACGATCCTAGGGTTTGGTATGTTTACCATTGCTTTGAT
TGCACTGATTGTGAAATTGCTTAAAGAAGACAAAAAGAAATGA
Antitoxin
Download Length: 64 bp
>AT108319 NZ_CP031027:c2946750-2946687 [Enterococcus faecalis]
TTGTGCTATAATAGCAATGAAAAGAGAGATATGCTGTAACATACCTCTCTAGTGTAGAGCCGTT
TTGTGCTATAATAGCAATGAAAAGAGAGATATGCTGTAACATACCTCTCTAGTGTAGAGCCGTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|