Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 323247..323441 | Replicon | chromosome |
Accession | NZ_CP031027 | ||
Organism | Enterococcus faecalis strain TY1 isolate flatfish |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | DTO64_RS16820 | Protein ID | WP_015543884.1 |
Coordinates | 323346..323441 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 323247..323311 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DTO64_RS01705 | 318859..320607 | + | 1749 | WP_010708249.1 | PTS transporter subunit EIIC | - |
DTO64_RS01710 | 320598..322631 | + | 2034 | WP_002358390.1 | transcription antiterminator | - |
DTO64_RS01715 | 322642..323076 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 323247..323311 | + | 65 | - | - | Antitoxin |
DTO64_RS16820 | 323346..323441 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
DTO64_RS01725 | 323687..325459 | + | 1773 | WP_010708250.1 | PTS mannitol transporter subunit IICBA | - |
DTO64_RS01730 | 325474..325911 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
DTO64_RS01735 | 325926..327080 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
DTO64_RS01740 | 327148..328263 | - | 1116 | WP_002358395.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T108308 WP_015543884.1 NZ_CP031027:c323441-323346 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T108308 NZ_CP031027:c323441-323346 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT108308 NZ_CP031027:323247-323311 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|