Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | bsrG-SR6/- |
Location | 2278844..2279008 | Replicon | chromosome |
Accession | NZ_CP030937 | ||
Organism | Bacillus sp. DM2 |
Toxin (Protein)
Gene name | bsrG | Uniprot ID | L8EAY0 |
Locus tag | DS740_RS22750 | Protein ID | WP_009967548.1 |
Coordinates | 2278844..2278960 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2278955..2279008 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DS740_RS11730 | 2273962..2274354 | + | 393 | WP_010328137.1 | hypothetical protein | - |
DS740_RS11735 | 2274375..2274626 | + | 252 | WP_114168631.1 | phage holin | - |
DS740_RS11740 | 2274753..2275889 | + | 1137 | WP_114168633.1 | tetratricopeptide repeat protein | - |
DS740_RS11745 | 2275879..2276055 | + | 177 | WP_019712878.1 | hypothetical protein | - |
DS740_RS11750 | 2276096..2277346 | - | 1251 | WP_114168635.1 | UV damage repair protein UvrX | - |
DS740_RS11755 | 2277339..2277671 | - | 333 | WP_114168637.1 | YolD-like family protein | - |
DS740_RS11760 | 2277845..2278180 | + | 336 | WP_041054825.1 | hypothetical protein | - |
DS740_RS11765 | 2278224..2278583 | - | 360 | WP_041338710.1 | hypothetical protein | - |
DS740_RS22750 | 2278844..2278960 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
- | 2278955..2279008 | - | 54 | NuclAT_2 | - | Antitoxin |
- | 2278955..2279008 | - | 54 | NuclAT_2 | - | Antitoxin |
- | 2278955..2279008 | - | 54 | NuclAT_2 | - | Antitoxin |
- | 2278955..2279008 | - | 54 | NuclAT_2 | - | Antitoxin |
DS740_RS11770 | 2279052..2279510 | - | 459 | WP_109962768.1 | SMI1/KNR4 family protein | - |
DS740_RS11775 | 2279523..2281409 | - | 1887 | WP_109962769.1 | HNH endonuclease | - |
DS740_RS11780 | 2281542..2282075 | - | 534 | WP_109962770.1 | SMI1/KNR4 family protein | - |
DS740_RS11785 | 2282160..2282410 | - | 251 | Protein_2257 | hypothetical protein | - |
DS740_RS11790 | 2282590..2283474 | + | 885 | WP_109962771.1 | endonuclease YokF | - |
DS740_RS11795 | 2283517..2283990 | - | 474 | WP_109962772.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2163700..2286801 | 123101 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T108238 WP_009967548.1 NZ_CP030937:2278844-2278960 [Bacillus sp. DM2]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
>T108238 NZ_CP030937:2278844-2278960 [Bacillus sp. DM2]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
Antitoxin
Download Length: 54 bp
>AT108238 NZ_CP030937:c2279008-2278955 [Bacillus sp. DM2]
AAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAAACTCAAGGGAAGGTCTATTT
AAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAAACTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|