Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 111540..111794 | Replicon | plasmid pAPEC-O2-211A-ColV |
Accession | NZ_CP030791 | ||
Organism | Escherichia coli APEC O2-211 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | - |
Locus tag | APECO2_RS27260 | Protein ID | WP_001351576.1 |
Coordinates | 111540..111746 (-) | Length | 69 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 111733..111794 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
APECO2_RS27215 | 107083..107430 | + | 348 | Protein_102 | IS1-like element IS1A family transposase | - |
APECO2_RS27225 | 107870..108157 | - | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
APECO2_RS27230 | 108154..108405 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
APECO2_RS27235 | 109368..110225 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
APECO2_RS27240 | 110218..110700 | - | 483 | WP_001273588.1 | hypothetical protein | - |
APECO2_RS27245 | 110693..110767 | - | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
APECO2_RS27255 | 110999..111256 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
APECO2_RS27260 | 111540..111746 | - | 207 | WP_001351576.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 111733..111794 | + | 62 | NuclAT_1 | - | Antitoxin |
- | 111733..111794 | + | 62 | NuclAT_1 | - | Antitoxin |
- | 111733..111794 | + | 62 | NuclAT_1 | - | Antitoxin |
- | 111733..111794 | + | 62 | NuclAT_1 | - | Antitoxin |
APECO2_RS28155 | 112050..112124 | - | 75 | Protein_110 | endonuclease | - |
APECO2_RS27270 | 112370..112582 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
APECO2_RS27275 | 112718..113278 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
APECO2_RS27280 | 113381..114241 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
APECO2_RS27285 | 114300..115046 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / vat / iutA / iucD / iucC / iucB / iucA | 1..197773 | 197773 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7826.31 Da Isoelectric Point: 8.8807
>T108064 WP_001351576.1 NZ_CP030791:c111746-111540 [Escherichia coli APEC O2-211]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
>T108064 NZ_CP030791:c111746-111540 [Escherichia coli APEC O2-211]
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCTGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCTGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT108064 NZ_CP030791:111733-111794 [Escherichia coli APEC O2-211]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|