Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3677351..3677608 | Replicon | chromosome |
Accession | NZ_CP030781 | ||
Organism | Escherichia albertii strain 07-3866 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | V0YDF1 |
Locus tag | CCF18_RS18400 | Protein ID | WP_001135738.1 |
Coordinates | 3677351..3677503 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 3677554..3677608 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CCF18_RS18375 | 3673455..3674114 | + | 660 | WP_029397571.1 | OmpA family lipoprotein | - |
CCF18_RS18380 | 3674218..3675192 | + | 975 | WP_125317713.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
CCF18_RS18385 | 3675245..3675955 | - | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
CCF18_RS18390 | 3676378..3676668 | + | 291 | WP_000455794.1 | HTH-type transcriptional regulator | - |
CCF18_RS18395 | 3676951..3677163 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
CCF18_RS18400 | 3677351..3677503 | - | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
- | 3677554..3677608 | + | 55 | - | - | Antitoxin |
CCF18_RS18405 | 3677825..3679894 | - | 2070 | WP_001291807.1 | glycine--tRNA ligase subunit beta | - |
CCF18_RS18410 | 3679904..3680815 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
CCF18_RS18415 | 3680911..3681210 | - | 300 | WP_000979961.1 | YsaB family lipoprotein | - |
CCF18_RS18420 | 3681383..3682378 | + | 996 | WP_001182625.1 | acyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T107995 WP_001135738.1 NZ_CP030781:c3677503-3677351 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
>T107995 NZ_CP030781:c3677503-3677351 [Escherichia albertii]
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAATCTGAAAGAGTAA
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAATCTGAAAGAGTAA
Antitoxin
Download Length: 55 bp
>AT107995 NZ_CP030781:3677554-3677608 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|