Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4118866..4119087 Replicon chromosome
Accession NZ_CP030768
Organism Escherichia coli strain 2017C-4173W12

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag DSB71_RS21290 Protein ID WP_000170965.1
Coordinates 4118866..4118973 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4119021..4119087 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DSB71_RS21265 4114711..4115793 + 1083 WP_000804726.1 peptide chain release factor 1 -
DSB71_RS21270 4115793..4116626 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
DSB71_RS21275 4116623..4117015 + 393 WP_000151883.1 invasion regulator SirB2 -
DSB71_RS21280 4117019..4117828 + 810 WP_001257044.1 invasion regulator SirB1 -
DSB71_RS21285 4117864..4118718 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
DSB71_RS21290 4118866..4118973 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4119021..4119087 + 67 NuclAT_14 - Antitoxin
- 4119021..4119087 + 67 NuclAT_14 - Antitoxin
- 4119021..4119087 + 67 NuclAT_14 - Antitoxin
- 4119021..4119087 + 67 NuclAT_14 - Antitoxin
- 4119021..4119087 + 67 NuclAT_16 - Antitoxin
- 4119021..4119087 + 67 NuclAT_16 - Antitoxin
- 4119021..4119087 + 67 NuclAT_16 - Antitoxin
- 4119021..4119087 + 67 NuclAT_16 - Antitoxin
- 4119021..4119087 + 67 NuclAT_18 - Antitoxin
- 4119021..4119087 + 67 NuclAT_18 - Antitoxin
- 4119021..4119087 + 67 NuclAT_18 - Antitoxin
- 4119021..4119087 + 67 NuclAT_18 - Antitoxin
- 4119021..4119087 + 67 NuclAT_20 - Antitoxin
- 4119021..4119087 + 67 NuclAT_20 - Antitoxin
- 4119021..4119087 + 67 NuclAT_20 - Antitoxin
- 4119021..4119087 + 67 NuclAT_20 - Antitoxin
- 4119021..4119087 + 67 NuclAT_22 - Antitoxin
- 4119021..4119087 + 67 NuclAT_22 - Antitoxin
- 4119021..4119087 + 67 NuclAT_22 - Antitoxin
- 4119021..4119087 + 67 NuclAT_22 - Antitoxin
- 4119021..4119087 + 67 NuclAT_24 - Antitoxin
- 4119021..4119087 + 67 NuclAT_24 - Antitoxin
- 4119021..4119087 + 67 NuclAT_24 - Antitoxin
- 4119021..4119087 + 67 NuclAT_24 - Antitoxin
- 4119023..4119086 + 64 NuclAT_27 - -
- 4119023..4119086 + 64 NuclAT_27 - -
- 4119023..4119086 + 64 NuclAT_27 - -
- 4119023..4119086 + 64 NuclAT_27 - -
- 4119023..4119086 + 64 NuclAT_29 - -
- 4119023..4119086 + 64 NuclAT_29 - -
- 4119023..4119086 + 64 NuclAT_29 - -
- 4119023..4119086 + 64 NuclAT_29 - -
- 4119023..4119086 + 64 NuclAT_31 - -
- 4119023..4119086 + 64 NuclAT_31 - -
- 4119023..4119086 + 64 NuclAT_31 - -
- 4119023..4119086 + 64 NuclAT_31 - -
- 4119023..4119086 + 64 NuclAT_33 - -
- 4119023..4119086 + 64 NuclAT_33 - -
- 4119023..4119086 + 64 NuclAT_33 - -
- 4119023..4119086 + 64 NuclAT_33 - -
- 4119023..4119086 + 64 NuclAT_35 - -
- 4119023..4119086 + 64 NuclAT_35 - -
- 4119023..4119086 + 64 NuclAT_35 - -
- 4119023..4119086 + 64 NuclAT_35 - -
- 4119023..4119086 + 64 NuclAT_37 - -
- 4119023..4119086 + 64 NuclAT_37 - -
- 4119023..4119086 + 64 NuclAT_37 - -
- 4119023..4119086 + 64 NuclAT_37 - -
- 4119023..4119088 + 66 NuclAT_39 - -
- 4119023..4119088 + 66 NuclAT_39 - -
- 4119023..4119088 + 66 NuclAT_39 - -
- 4119023..4119088 + 66 NuclAT_39 - -
DSB71_RS21295 4119401..4119508 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 4119561..4119622 + 62 NuclAT_26 - -
- 4119561..4119622 + 62 NuclAT_26 - -
- 4119561..4119622 + 62 NuclAT_26 - -
- 4119561..4119622 + 62 NuclAT_26 - -
- 4119561..4119622 + 62 NuclAT_28 - -
- 4119561..4119622 + 62 NuclAT_28 - -
- 4119561..4119622 + 62 NuclAT_28 - -
- 4119561..4119622 + 62 NuclAT_28 - -
- 4119561..4119622 + 62 NuclAT_30 - -
- 4119561..4119622 + 62 NuclAT_30 - -
- 4119561..4119622 + 62 NuclAT_30 - -
- 4119561..4119622 + 62 NuclAT_30 - -
- 4119561..4119622 + 62 NuclAT_32 - -
- 4119561..4119622 + 62 NuclAT_32 - -
- 4119561..4119622 + 62 NuclAT_32 - -
- 4119561..4119622 + 62 NuclAT_32 - -
- 4119561..4119622 + 62 NuclAT_34 - -
- 4119561..4119622 + 62 NuclAT_34 - -
- 4119561..4119622 + 62 NuclAT_34 - -
- 4119561..4119622 + 62 NuclAT_34 - -
- 4119561..4119622 + 62 NuclAT_36 - -
- 4119561..4119622 + 62 NuclAT_36 - -
- 4119561..4119622 + 62 NuclAT_36 - -
- 4119561..4119622 + 62 NuclAT_36 - -
- 4119561..4119623 + 63 NuclAT_15 - -
- 4119561..4119623 + 63 NuclAT_15 - -
- 4119561..4119623 + 63 NuclAT_15 - -
- 4119561..4119623 + 63 NuclAT_15 - -
- 4119561..4119623 + 63 NuclAT_17 - -
- 4119561..4119623 + 63 NuclAT_17 - -
- 4119561..4119623 + 63 NuclAT_17 - -
- 4119561..4119623 + 63 NuclAT_17 - -
- 4119561..4119623 + 63 NuclAT_19 - -
- 4119561..4119623 + 63 NuclAT_19 - -
- 4119561..4119623 + 63 NuclAT_19 - -
- 4119561..4119623 + 63 NuclAT_19 - -
- 4119561..4119623 + 63 NuclAT_21 - -
- 4119561..4119623 + 63 NuclAT_21 - -
- 4119561..4119623 + 63 NuclAT_21 - -
- 4119561..4119623 + 63 NuclAT_21 - -
- 4119561..4119623 + 63 NuclAT_23 - -
- 4119561..4119623 + 63 NuclAT_23 - -
- 4119561..4119623 + 63 NuclAT_23 - -
- 4119561..4119623 + 63 NuclAT_23 - -
- 4119561..4119623 + 63 NuclAT_25 - -
- 4119561..4119623 + 63 NuclAT_25 - -
- 4119561..4119623 + 63 NuclAT_25 - -
- 4119561..4119623 + 63 NuclAT_25 - -
- 4119561..4119624 + 64 NuclAT_38 - -
- 4119561..4119624 + 64 NuclAT_38 - -
- 4119561..4119624 + 64 NuclAT_38 - -
- 4119561..4119624 + 64 NuclAT_38 - -
DSB71_RS21305 4119914..4121014 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
DSB71_RS21310 4121284..4121514 + 231 WP_001146444.1 putative cation transport regulator ChaB -
DSB71_RS21315 4121672..4122367 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
DSB71_RS21320 4122411..4122764 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T107911 WP_000170965.1 NZ_CP030768:c4118973-4118866 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T107911 NZ_CP030768:c4118973-4118866 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT107911 NZ_CP030768:4119021-4119087 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References