Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 7528..7792 | Replicon | plasmid unnamed2 |
Accession | NZ_CP030340 | ||
Organism | Escherichia coli strain AR_451 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | - |
Locus tag | CSC38_RS26900 | Protein ID | WP_024179514.1 |
Coordinates | 7640..7792 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 7528..7590 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSC38_RS26885 | 2767..5058 | - | 2292 | WP_001289267.1 | hypothetical protein | - |
CSC38_RS26890 | 5051..6121 | - | 1071 | WP_015059313.1 | IncI1-type conjugal transfer protein TrbB | - |
CSC38_RS26895 | 6140..7348 | - | 1209 | WP_024171190.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 7528..7590 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 7528..7590 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 7528..7590 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 7528..7590 | - | 63 | NuclAT_0 | - | Antitoxin |
CSC38_RS26900 | 7640..7792 | + | 153 | WP_024179514.1 | Hok/Gef family protein | Toxin |
CSC38_RS26905 | 7864..8115 | - | 252 | WP_001291965.1 | hypothetical protein | - |
- | 8509..8560 | - | 52 | NuclAT_1 | - | - |
- | 8509..8560 | - | 52 | NuclAT_1 | - | - |
- | 8509..8560 | - | 52 | NuclAT_1 | - | - |
- | 8509..8560 | - | 52 | NuclAT_1 | - | - |
CSC38_RS27445 | 9400..9576 | - | 177 | WP_001054898.1 | hypothetical protein | - |
CSC38_RS26915 | 9785..9994 | - | 210 | WP_015059315.1 | hemolysin expression modulator Hha | - |
CSC38_RS26920 | 10092..10706 | - | 615 | WP_015059316.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..34927 | 34927 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5795.12 Da Isoelectric Point: 8.7948
>T107777 WP_024179514.1 NZ_CP030340:7640-7792 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGFRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGFRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T107777 NZ_CP030340:7640-7792 [Escherichia coli]
ATGCCACAGCGAACATTTTTAATGATGTTGATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGATTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACATTTTTAATGATGTTGATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGATTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT107777 NZ_CP030340:c7590-7528 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|