Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 7800..8042 | Replicon | plasmid unnamed3 |
Accession | NZ_CP030339 | ||
Organism | Escherichia coli strain AR_451 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CSC38_RS26685 | Protein ID | WP_001312861.1 |
Coordinates | 7800..7958 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 8002..8042 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSC38_RS26640 | 2912..3139 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
CSC38_RS26645 | 3227..3904 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
CSC38_RS26650 | 4038..4421 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
CSC38_RS26655 | 4752..5354 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
CSC38_RS26660 | 5651..6472 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
CSC38_RS26665 | 6591..6878 | - | 288 | WP_000107535.1 | hypothetical protein | - |
CSC38_RS27425 | 6903..7109 | - | 207 | WP_000275859.1 | hypothetical protein | - |
CSC38_RS27430 | 7022..7357 | - | 336 | WP_013023876.1 | hypothetical protein | - |
CSC38_RS26685 | 7800..7958 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 8002..8042 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 8002..8042 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 8002..8042 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 8002..8042 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 9486..9672 | - | 187 | NuclAT_0 | - | - |
- | 9486..9672 | - | 187 | NuclAT_0 | - | - |
- | 9486..9672 | - | 187 | NuclAT_0 | - | - |
- | 9486..9672 | - | 187 | NuclAT_0 | - | - |
CSC38_RS26695 | 9684..10403 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
CSC38_RS26700 | 10400..10834 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
CSC38_RS26705 | 10889..12846 | - | 1958 | Protein_19 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..35509 | 35509 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T107772 WP_001312861.1 NZ_CP030339:c7958-7800 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T107772 NZ_CP030339:c7958-7800 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 41 bp
>AT107772 NZ_CP030339:c8042-8002 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|