Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2133756..2134055 | Replicon | chromosome |
Accession | NZ_CP030326 | ||
Organism | Staphylococcus aureus strain AR_474 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | CSC59_RS11355 | Protein ID | WP_011447039.1 |
Coordinates | 2133879..2134055 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2133756..2133811 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSC59_RS11305 | 2129087..2129347 | + | 261 | WP_001791826.1 | hypothetical protein | - |
CSC59_RS11310 | 2129400..2129750 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
CSC59_RS11315 | 2130435..2130884 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
CSC59_RS11320 | 2130979..2131314 | - | 336 | Protein_2062 | SH3 domain-containing protein | - |
CSC59_RS11335 | 2131964..2132455 | - | 492 | WP_000919350.1 | staphylokinase | - |
CSC59_RS11340 | 2132646..2133401 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
CSC59_RS11345 | 2133413..2133667 | - | 255 | WP_000611512.1 | phage holin | - |
CSC59_RS11350 | 2133719..2133826 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2133748..2133887 | + | 140 | NuclAT_0 | - | - |
- | 2133748..2133887 | + | 140 | NuclAT_0 | - | - |
- | 2133748..2133887 | + | 140 | NuclAT_0 | - | - |
- | 2133748..2133887 | + | 140 | NuclAT_0 | - | - |
- | 2133756..2133811 | + | 56 | - | - | Antitoxin |
CSC59_RS11355 | 2133879..2134055 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
CSC59_RS11360 | 2134205..2134501 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
CSC59_RS11365 | 2134559..2134846 | - | 288 | WP_001040261.1 | hypothetical protein | - |
CSC59_RS11370 | 2134893..2135045 | - | 153 | WP_001153681.1 | hypothetical protein | - |
CSC59_RS11375 | 2135035..2138820 | - | 3786 | WP_000582154.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2129400..2182918 | 53518 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T107697 WP_011447039.1 NZ_CP030326:c2134055-2133879 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T107697 NZ_CP030326:c2134055-2133879 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT107697 NZ_CP030326:2133756-2133811 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|