Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 828768..828952 | Replicon | chromosome |
Accession | NZ_CP030323 | ||
Organism | Staphylococcus aureus strain AR_475 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | CSC60_RS03990 | Protein ID | WP_000482647.1 |
Coordinates | 828768..828875 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 828892..828952 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSC60_RS03965 | 824130..824603 | + | 474 | WP_000456483.1 | GyrI-like domain-containing protein | - |
CSC60_RS03970 | 824726..825937 | - | 1212 | WP_001191921.1 | multidrug effflux MFS transporter | - |
CSC60_RS03975 | 826120..826779 | - | 660 | WP_000831298.1 | membrane protein | - |
CSC60_RS03980 | 826839..827981 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
CSC60_RS03985 | 828249..828635 | + | 387 | WP_000779353.1 | flippase GtxA | - |
CSC60_RS03990 | 828768..828875 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 828892..828952 | - | 61 | - | - | Antitoxin |
CSC60_RS14420 | 828902..829069 | + | 168 | WP_000301893.1 | hypothetical protein | - |
CSC60_RS03995 | 829523..831286 | + | 1764 | WP_001064822.1 | ABC transporter ATP-binding protein/permease | - |
CSC60_RS04000 | 831311..833044 | + | 1734 | WP_000488493.1 | ABC transporter ATP-binding protein/permease | - |
CSC60_RS04010 | 833275..833442 | + | 168 | WP_031845053.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T107671 WP_000482647.1 NZ_CP030323:828768-828875 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T107671 NZ_CP030323:828768-828875 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT107671 NZ_CP030323:c828952-828892 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|