Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 74927..75353 | Replicon | plasmid p283747-1 |
Accession | NZ_CP030301 | ||
Organism | Klebsiella pneumoniae strain 283747 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | DRB02_RS27615 | Protein ID | WP_001372321.1 |
Coordinates | 74927..75052 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 75129..75353 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DRB02_RS27580 (69982) | 69982..70209 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
DRB02_RS27585 (70303) | 70303..70989 | - | 687 | WP_015059009.1 | PAS domain-containing protein | - |
DRB02_RS27590 (71180) | 71180..71563 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
DRB02_RS27595 (71840) | 71840..72487 | + | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
DRB02_RS27600 (72784) | 72784..73605 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
DRB02_RS27605 (73716) | 73716..74012 | - | 297 | WP_001272251.1 | hypothetical protein | - |
DRB02_RS27610 (74312) | 74312..74608 | + | 297 | Protein_105 | hypothetical protein | - |
DRB02_RS27615 (74927) | 74927..75052 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
DRB02_RS28320 (74994) | 74994..75143 | - | 150 | Protein_107 | plasmid maintenance protein Mok | - |
- (75129) | 75129..75353 | - | 225 | NuclAT_0 | - | Antitoxin |
- (75129) | 75129..75353 | - | 225 | NuclAT_0 | - | Antitoxin |
- (75129) | 75129..75353 | - | 225 | NuclAT_0 | - | Antitoxin |
- (75129) | 75129..75353 | - | 225 | NuclAT_0 | - | Antitoxin |
DRB02_RS27620 (75365) | 75365..76084 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
DRB02_RS27625 (76081) | 76081..76515 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
DRB02_RS27630 (76584) | 76584..78607 | - | 2024 | Protein_110 | ParB/RepB/Spo0J family partition protein | - |
DRB02_RS27635 (78668) | 78668..78901 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
DRB02_RS27640 (78959) | 78959..79486 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
DRB02_RS28325 (79788) | 79788..80243 | + | 456 | Protein_113 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaKPC-2 / blaSHV-12 / rmtB / blaTEM-1B / fosA3 / blaCTX-M-65 | - | 1..148021 | 148021 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T107554 WP_001372321.1 NZ_CP030301:c75052-74927 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T107554 NZ_CP030301:c75052-74927 [Klebsiella pneumoniae]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT107554 NZ_CP030301:c75353-75129 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|