Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3399842..3400064 Replicon chromosome
Accession NZ_CP030240
Organism Escherichia coli strain ER1709

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag DQ225_RS16465 Protein ID WP_000170963.1
Coordinates 3399842..3399949 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3399997..3400064 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQ225_RS16435 3395151..3396233 + 1083 WP_000804726.1 peptide chain release factor 1 -
DQ225_RS16440 3396233..3397066 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
DQ225_RS16445 3397063..3397455 + 393 WP_000200374.1 invasion regulator SirB2 -
DQ225_RS16450 3397459..3398268 + 810 WP_001257044.1 invasion regulator SirB1 -
DQ225_RS16455 3398304..3399158 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
DQ225_RS16460 3399307..3399414 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 3399462..3399528 + 67 NuclAT_34 - -
- 3399462..3399528 + 67 NuclAT_34 - -
- 3399462..3399528 + 67 NuclAT_34 - -
- 3399462..3399528 + 67 NuclAT_34 - -
- 3399462..3399528 + 67 NuclAT_36 - -
- 3399462..3399528 + 67 NuclAT_36 - -
- 3399462..3399528 + 67 NuclAT_36 - -
- 3399462..3399528 + 67 NuclAT_36 - -
- 3399462..3399528 + 67 NuclAT_38 - -
- 3399462..3399528 + 67 NuclAT_38 - -
- 3399462..3399528 + 67 NuclAT_38 - -
- 3399462..3399528 + 67 NuclAT_38 - -
- 3399462..3399528 + 67 NuclAT_40 - -
- 3399462..3399528 + 67 NuclAT_40 - -
- 3399462..3399528 + 67 NuclAT_40 - -
- 3399462..3399528 + 67 NuclAT_40 - -
- 3399462..3399528 + 67 NuclAT_42 - -
- 3399462..3399528 + 67 NuclAT_42 - -
- 3399462..3399528 + 67 NuclAT_42 - -
- 3399462..3399528 + 67 NuclAT_42 - -
- 3399462..3399528 + 67 NuclAT_44 - -
- 3399462..3399528 + 67 NuclAT_44 - -
- 3399462..3399528 + 67 NuclAT_44 - -
- 3399462..3399528 + 67 NuclAT_44 - -
- 3399464..3399529 + 66 NuclAT_18 - -
- 3399464..3399529 + 66 NuclAT_18 - -
- 3399464..3399529 + 66 NuclAT_18 - -
- 3399464..3399529 + 66 NuclAT_18 - -
- 3399464..3399529 + 66 NuclAT_21 - -
- 3399464..3399529 + 66 NuclAT_21 - -
- 3399464..3399529 + 66 NuclAT_21 - -
- 3399464..3399529 + 66 NuclAT_21 - -
- 3399464..3399529 + 66 NuclAT_24 - -
- 3399464..3399529 + 66 NuclAT_24 - -
- 3399464..3399529 + 66 NuclAT_24 - -
- 3399464..3399529 + 66 NuclAT_24 - -
- 3399464..3399529 + 66 NuclAT_27 - -
- 3399464..3399529 + 66 NuclAT_27 - -
- 3399464..3399529 + 66 NuclAT_27 - -
- 3399464..3399529 + 66 NuclAT_27 - -
- 3399464..3399529 + 66 NuclAT_30 - -
- 3399464..3399529 + 66 NuclAT_30 - -
- 3399464..3399529 + 66 NuclAT_30 - -
- 3399464..3399529 + 66 NuclAT_30 - -
- 3399464..3399529 + 66 NuclAT_33 - -
- 3399464..3399529 + 66 NuclAT_33 - -
- 3399464..3399529 + 66 NuclAT_33 - -
- 3399464..3399529 + 66 NuclAT_33 - -
DQ225_RS16465 3399842..3399949 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 3399997..3400064 + 68 NuclAT_17 - Antitoxin
- 3399997..3400064 + 68 NuclAT_17 - Antitoxin
- 3399997..3400064 + 68 NuclAT_17 - Antitoxin
- 3399997..3400064 + 68 NuclAT_17 - Antitoxin
- 3399997..3400064 + 68 NuclAT_20 - Antitoxin
- 3399997..3400064 + 68 NuclAT_20 - Antitoxin
- 3399997..3400064 + 68 NuclAT_20 - Antitoxin
- 3399997..3400064 + 68 NuclAT_20 - Antitoxin
- 3399997..3400064 + 68 NuclAT_23 - Antitoxin
- 3399997..3400064 + 68 NuclAT_23 - Antitoxin
- 3399997..3400064 + 68 NuclAT_23 - Antitoxin
- 3399997..3400064 + 68 NuclAT_23 - Antitoxin
- 3399997..3400064 + 68 NuclAT_26 - Antitoxin
- 3399997..3400064 + 68 NuclAT_26 - Antitoxin
- 3399997..3400064 + 68 NuclAT_26 - Antitoxin
- 3399997..3400064 + 68 NuclAT_26 - Antitoxin
- 3399997..3400064 + 68 NuclAT_29 - Antitoxin
- 3399997..3400064 + 68 NuclAT_29 - Antitoxin
- 3399997..3400064 + 68 NuclAT_29 - Antitoxin
- 3399997..3400064 + 68 NuclAT_29 - Antitoxin
- 3399997..3400064 + 68 NuclAT_32 - Antitoxin
- 3399997..3400064 + 68 NuclAT_32 - Antitoxin
- 3399997..3400064 + 68 NuclAT_32 - Antitoxin
- 3399997..3400064 + 68 NuclAT_32 - Antitoxin
- 3399998..3400063 + 66 NuclAT_35 - -
- 3399998..3400063 + 66 NuclAT_35 - -
- 3399998..3400063 + 66 NuclAT_35 - -
- 3399998..3400063 + 66 NuclAT_35 - -
- 3399998..3400063 + 66 NuclAT_37 - -
- 3399998..3400063 + 66 NuclAT_37 - -
- 3399998..3400063 + 66 NuclAT_37 - -
- 3399998..3400063 + 66 NuclAT_37 - -
- 3399998..3400063 + 66 NuclAT_39 - -
- 3399998..3400063 + 66 NuclAT_39 - -
- 3399998..3400063 + 66 NuclAT_39 - -
- 3399998..3400063 + 66 NuclAT_39 - -
- 3399998..3400063 + 66 NuclAT_41 - -
- 3399998..3400063 + 66 NuclAT_41 - -
- 3399998..3400063 + 66 NuclAT_41 - -
- 3399998..3400063 + 66 NuclAT_41 - -
- 3399998..3400063 + 66 NuclAT_43 - -
- 3399998..3400063 + 66 NuclAT_43 - -
- 3399998..3400063 + 66 NuclAT_43 - -
- 3399998..3400063 + 66 NuclAT_43 - -
- 3399998..3400063 + 66 NuclAT_45 - -
- 3399998..3400063 + 66 NuclAT_45 - -
- 3399998..3400063 + 66 NuclAT_45 - -
- 3399998..3400063 + 66 NuclAT_45 - -
DQ225_RS16470 3400377..3400484 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 3400532..3400599 + 68 NuclAT_16 - -
- 3400532..3400599 + 68 NuclAT_16 - -
- 3400532..3400599 + 68 NuclAT_16 - -
- 3400532..3400599 + 68 NuclAT_16 - -
- 3400532..3400599 + 68 NuclAT_19 - -
- 3400532..3400599 + 68 NuclAT_19 - -
- 3400532..3400599 + 68 NuclAT_19 - -
- 3400532..3400599 + 68 NuclAT_19 - -
- 3400532..3400599 + 68 NuclAT_22 - -
- 3400532..3400599 + 68 NuclAT_22 - -
- 3400532..3400599 + 68 NuclAT_22 - -
- 3400532..3400599 + 68 NuclAT_22 - -
- 3400532..3400599 + 68 NuclAT_25 - -
- 3400532..3400599 + 68 NuclAT_25 - -
- 3400532..3400599 + 68 NuclAT_25 - -
- 3400532..3400599 + 68 NuclAT_25 - -
- 3400532..3400599 + 68 NuclAT_28 - -
- 3400532..3400599 + 68 NuclAT_28 - -
- 3400532..3400599 + 68 NuclAT_28 - -
- 3400532..3400599 + 68 NuclAT_28 - -
- 3400532..3400599 + 68 NuclAT_31 - -
- 3400532..3400599 + 68 NuclAT_31 - -
- 3400532..3400599 + 68 NuclAT_31 - -
- 3400532..3400599 + 68 NuclAT_31 - -
DQ225_RS16480 3400888..3401988 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
DQ225_RS16485 3402258..3402488 + 231 WP_001146444.1 putative cation transport regulator ChaB -
DQ225_RS16490 3402646..3403341 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
DQ225_RS16495 3403385..3403738 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T107379 WP_000170963.1 NZ_CP030240:c3399949-3399842 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T107379 NZ_CP030240:c3399949-3399842 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT107379 NZ_CP030240:3399997-3400064 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References