Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1261195..1261417 | Replicon | chromosome |
Accession | NZ_CP030240 | ||
Organism | Escherichia coli strain ER1709 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1E8T8 |
Locus tag | DQ225_RS06125 | Protein ID | WP_000141634.1 |
Coordinates | 1261195..1261302 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1261351..1261417 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQ225_RS06100 | 1256448..1257200 | - | 753 | Protein_1186 | cellulose biosynthesis protein BcsQ | - |
DQ225_RS06105 | 1257212..1257400 | - | 189 | WP_001063318.1 | YhjR family protein | - |
DQ225_RS06110 | 1257673..1259244 | + | 1572 | WP_001204927.1 | cellulose biosynthesis protein BcsE | - |
DQ225_RS06115 | 1259241..1259432 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
DQ225_RS06120 | 1259429..1261108 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
DQ225_RS06125 | 1261195..1261302 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
- | 1261351..1261417 | + | 67 | - | - | Antitoxin |
DQ225_RS06130 | 1261778..1263049 | + | 1272 | WP_001295225.1 | transporter | - |
DQ225_RS06135 | 1263079..1264083 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
DQ225_RS06140 | 1264080..1265063 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
DQ225_RS06145 | 1265074..1265976 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T107367 WP_000141634.1 NZ_CP030240:c1261302-1261195 [Escherichia coli]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T107367 NZ_CP030240:c1261302-1261195 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT107367 NZ_CP030240:1261351-1261417 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|