Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2425612..2425829 | Replicon | chromosome |
Accession | NZ_CP030138 | ||
Organism | Staphylococcus aureus strain M48 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | C2G36_RS12985 | Protein ID | WP_001802298.1 |
Coordinates | 2425725..2425829 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2425612..2425667 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C2G36_RS12965 | 2421749..2422414 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
C2G36_RS12970 | 2422566..2422886 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
C2G36_RS12975 | 2422888..2423868 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
C2G36_RS12980 | 2424134..2425225 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2425612..2425667 | + | 56 | - | - | Antitoxin |
C2G36_RS12985 | 2425725..2425829 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
C2G36_RS16325 | 2425990..2426473 | - | 484 | Protein_2410 | recombinase family protein | - |
C2G36_RS12995 | 2426516..2427652 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
C2G36_RS13000 | 2427941..2428033 | + | 93 | WP_001790138.1 | hypothetical protein | - |
C2G36_RS13005 | 2428738..2429438 | - | 701 | Protein_2413 | HAD family phosphatase | - |
C2G36_RS13010 | 2429506..2430288 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T107213 WP_001802298.1 NZ_CP030138:c2425829-2425725 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T107213 NZ_CP030138:c2425829-2425725 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT107213 NZ_CP030138:2425612-2425667 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|