Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2119851..2120150 | Replicon | chromosome |
Accession | NZ_CP030138 | ||
Organism | Staphylococcus aureus strain M48 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
Locus tag | C2G36_RS11190 | Protein ID | WP_072482930.1 |
Coordinates | 2119974..2120150 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2119851..2119906 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C2G36_RS11135 | 2115409..2115588 | + | 180 | WP_000669789.1 | hypothetical protein | - |
C2G36_RS11145 | 2115899..2116159 | + | 261 | WP_001791826.1 | hypothetical protein | - |
C2G36_RS11150 | 2116212..2116562 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
C2G36_RS11155 | 2117072..2117407 | - | 336 | Protein_2057 | SH3 domain-containing protein | - |
C2G36_RS11170 | 2118059..2118550 | - | 492 | WP_000920041.1 | staphylokinase | - |
C2G36_RS11175 | 2118741..2119496 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
C2G36_RS11180 | 2119508..2119762 | - | 255 | WP_000611512.1 | phage holin | - |
C2G36_RS11185 | 2119814..2119921 | + | 108 | Protein_2061 | hypothetical protein | - |
- | 2119843..2119982 | + | 140 | NuclAT_0 | - | - |
- | 2119843..2119982 | + | 140 | NuclAT_0 | - | - |
- | 2119843..2119982 | + | 140 | NuclAT_0 | - | - |
- | 2119843..2119982 | + | 140 | NuclAT_0 | - | - |
- | 2119851..2119906 | + | 56 | - | - | Antitoxin |
C2G36_RS11190 | 2119974..2120150 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
C2G36_RS11195 | 2120259..2121032 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
C2G36_RS11200 | 2121405..2121779 | - | 375 | WP_000340977.1 | hypothetical protein | - |
C2G36_RS11205 | 2121835..2122122 | - | 288 | WP_001262621.1 | hypothetical protein | - |
C2G36_RS11210 | 2122168..2122320 | - | 153 | WP_001000059.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / sea / hlb / groEL | 2116212..2175057 | 58845 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T107203 WP_072482930.1 NZ_CP030138:c2120150-2119974 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
>T107203 NZ_CP030138:c2120150-2119974 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT107203 NZ_CP030138:2119851-2119906 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|