Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1917667..1917849 | Replicon | chromosome |
Accession | NZ_CP030138 | ||
Organism | Staphylococcus aureus strain M48 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | C2G36_RS09785 | Protein ID | WP_001801861.1 |
Coordinates | 1917667..1917762 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1917790..1917849 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C2G36_RS09735 | 1913327..1913953 | + | 627 | WP_000669046.1 | hypothetical protein | - |
C2G36_RS09740 | 1913994..1914338 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
C2G36_RS09745 | 1914436..1914987 | + | 552 | WP_000414205.1 | hypothetical protein | - |
C2G36_RS09750 | 1915205..1915846 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
C2G36_RS09755 | 1915960..1916145 | - | 186 | WP_000809857.1 | hypothetical protein | - |
C2G36_RS09760 | 1916147..1916323 | - | 177 | WP_000375476.1 | hypothetical protein | - |
C2G36_RS09765 | 1916334..1916717 | - | 384 | WP_000070811.1 | hypothetical protein | - |
C2G36_RS09775 | 1917321..1917464 | - | 144 | WP_001549059.1 | transposase | - |
C2G36_RS09785 | 1917667..1917762 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1917790..1917849 | - | 60 | - | - | Antitoxin |
C2G36_RS09790 | 1917885..1917986 | + | 102 | WP_001791893.1 | hypothetical protein | - |
C2G36_RS09795 | 1917964..1918140 | - | 177 | Protein_1839 | transposase | - |
C2G36_RS09800 | 1918334..1918711 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T107199 WP_001801861.1 NZ_CP030138:1917667-1917762 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T107199 NZ_CP030138:1917667-1917762 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT107199 NZ_CP030138:c1917849-1917790 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|