Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 922634..922816 | Replicon | chromosome |
Accession | NZ_CP030137 | ||
Organism | Staphylococcus aureus strain M51 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | C2G35_RS05200 | Protein ID | WP_001801861.1 |
Coordinates | 922721..922816 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 922634..922693 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C2G35_RS05185 | 921772..922149 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
C2G35_RS05190 | 922343..922519 | + | 177 | Protein_928 | transposase | - |
C2G35_RS05195 | 922497..922598 | - | 102 | WP_001791893.1 | hypothetical protein | - |
- | 922634..922693 | + | 60 | - | - | Antitoxin |
C2G35_RS05200 | 922721..922816 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
C2G35_RS05210 | 923019..923162 | + | 144 | WP_001549059.1 | transposase | - |
C2G35_RS05220 | 923766..924149 | + | 384 | WP_000070811.1 | hypothetical protein | - |
C2G35_RS05225 | 924160..924336 | + | 177 | WP_000375476.1 | hypothetical protein | - |
C2G35_RS05230 | 924338..924523 | + | 186 | WP_000809857.1 | hypothetical protein | - |
C2G35_RS05235 | 924637..925278 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
C2G35_RS05240 | 925496..926047 | - | 552 | WP_000414205.1 | hypothetical protein | - |
C2G35_RS05245 | 926145..926489 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
C2G35_RS05250 | 926530..927156 | - | 627 | WP_129364309.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 904114..948842 | 44728 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T107194 WP_001801861.1 NZ_CP030137:c922816-922721 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T107194 NZ_CP030137:c922816-922721 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT107194 NZ_CP030137:922634-922693 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGTTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGTTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|