Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 316843..317027 | Replicon | chromosome |
Accession | NZ_CP030137 | ||
Organism | Staphylococcus aureus strain M51 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | C2G35_RS01610 | Protein ID | WP_000482650.1 |
Coordinates | 316843..316950 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 316967..317027 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C2G35_RS01585 | 312205..312678 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
C2G35_RS01590 | 312801..314012 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
C2G35_RS01595 | 314194..314853 | - | 660 | WP_000831298.1 | membrane protein | - |
C2G35_RS01600 | 314913..316055 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
C2G35_RS01605 | 316323..316709 | + | 387 | WP_000779358.1 | flippase GtxA | - |
C2G35_RS01610 | 316843..316950 | + | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 316967..317027 | - | 61 | - | - | Antitoxin |
C2G35_RS01620 | 317578..319341 | + | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
C2G35_RS01625 | 319366..321099 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
C2G35_RS01635 | 321330..321497 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T107181 WP_000482650.1 NZ_CP030137:316843-316950 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T107181 NZ_CP030137:316843-316950 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT107181 NZ_CP030137:c317027-316967 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|