Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 936741..936921 | Replicon | chromosome |
Accession | NZ_CP030136 | ||
Organism | Staphylococcus aureus strain S57 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CHN55_RS05245 | Protein ID | WP_001801861.1 |
Coordinates | 936826..936921 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 936741..936798 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CHN55_RS05225 | 932316..932996 | + | 681 | Protein_935 | DNA adenine methylase | - |
CHN55_RS05230 | 933048..934220 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
CHN55_RS05240 | 934480..936175 | + | 1696 | Protein_937 | hypothetical protein | - |
- | 936741..936798 | + | 58 | - | - | Antitoxin |
CHN55_RS05245 | 936826..936921 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
CHN55_RS05255 | 937373..937819 | + | 447 | WP_000747805.1 | DUF1433 domain-containing protein | - |
CHN55_RS05260 | 938003..938559 | + | 557 | Protein_940 | ImmA/IrrE family metallo-endopeptidase | - |
CHN55_RS05265 | 938691..939443 | - | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
CHN55_RS05270 | 939470..940213 | - | 744 | WP_175393121.1 | exotoxin | - |
CHN55_RS05275 | 940240..940866 | - | 627 | WP_000669028.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk | 914125..943425 | 29300 | |
- | flank | IS/Tn | - | - | 933048..934220 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T107177 WP_001801861.1 NZ_CP030136:c936921-936826 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T107177 NZ_CP030136:c936921-936826 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT107177 NZ_CP030136:936741-936798 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|