Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 29907..30160 | Replicon | plasmid pIncFII_L111 |
Accession | NZ_CP030133 | ||
Organism | Klebsiella pneumoniae strain 160111 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | DL890_RS29155 | Protein ID | WP_001312851.1 |
Coordinates | 29907..30056 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 30101..30160 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DL890_RS29105 | 25266..25681 | - | 416 | Protein_35 | IS1 family transposase | - |
DL890_RS29120 | 25930..26331 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
DL890_RS31420 | 26264..26521 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
DL890_RS29125 | 26614..27267 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
DL890_RS29135 | 28206..29063 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
DL890_RS29140 | 29056..29130 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
DL890_RS29150 | 29375..29623 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
DL890_RS29155 | 29907..30056 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 30101..30160 | + | 60 | NuclAT_0 | - | Antitoxin |
- | 30101..30160 | + | 60 | NuclAT_0 | - | Antitoxin |
- | 30101..30160 | + | 60 | NuclAT_0 | - | Antitoxin |
- | 30101..30160 | + | 60 | NuclAT_0 | - | Antitoxin |
DL890_RS29165 | 30361..30591 | - | 231 | WP_001736714.1 | hypothetical protein | - |
DL890_RS29170 | 30755..31354 | - | 600 | WP_032083981.1 | hypothetical protein | - |
DL890_RS29175 | 31740..31940 | - | 201 | WP_015059022.1 | hypothetical protein | - |
DL890_RS29180 | 32072..32632 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
DL890_RS29185 | 32687..33433 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
DL890_RS29190 | 33453..33614 | - | 162 | Protein_48 | DNA helicase | - |
DL890_RS29195 | 33678..34381 | + | 704 | Protein_49 | IS6-like element IS26 family transposase | - |
DL890_RS29200 | 34434..34499 | + | 66 | Protein_50 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..39248 | 39248 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T107159 WP_001312851.1 NZ_CP030133:c30056-29907 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T107159 NZ_CP030133:c30056-29907 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT107159 NZ_CP030133:30101-30160 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|