Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 46497..46712 | Replicon | plasmid pC54 |
Accession | NZ_CP030046 | ||
Organism | Enterococcus faecalis strain C54 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | DOU32_RS14620 | Protein ID | WP_002360667.1 |
Coordinates | 46602..46712 (-) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 46497..46561 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DOU32_RS14875 | 41763..42089 | - | 327 | WP_002387760.1 | DNA-binding protein | - |
DOU32_RS14585 | 42126..42290 | + | 165 | WP_001808810.1 | helix-turn-helix domain-containing protein | - |
DOU32_RS14590 | 42329..43009 | + | 681 | WP_000191454.1 | IS6-like element ISEnfa1 family transposase | - |
DOU32_RS14595 | 43078..43239 | - | 162 | Protein_49 | TraB/GumN family protein | - |
DOU32_RS14600 | 43410..44420 | - | 1011 | WP_002360662.1 | replication initiator protein A | - |
DOU32_RS14605 | 44680..45036 | - | 357 | WP_128713114.1 | hypothetical protein | - |
DOU32_RS14610 | 45029..45811 | - | 783 | WP_002360664.1 | ParA family protein | - |
DOU32_RS14615 | 46065..46361 | - | 297 | WP_002360665.1 | replication control protein PrgN | - |
- | 46497..46561 | + | 65 | - | - | Antitoxin |
DOU32_RS14620 | 46602..46712 | - | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
DOU32_RS14630 | 46963..47313 | - | 351 | WP_002360672.1 | hypothetical protein | - |
DOU32_RS14635 | 47310..48638 | - | 1329 | WP_138807346.1 | Y-family DNA polymerase | - |
DOU32_RS14640 | 49067..49369 | - | 303 | WP_128713120.1 | hypothetical protein | - |
DOU32_RS14645 | 49390..49590 | - | 201 | WP_002390466.1 | hypothetical protein | - |
DOU32_RS14650 | 49659..49883 | - | 225 | WP_002358271.1 | hypothetical protein | - |
DOU32_RS14655 | 49877..50191 | - | 315 | WP_002390465.1 | hypothetical protein | - |
DOU32_RS14660 | 50181..50801 | - | 621 | WP_161978277.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | fexA / optrA / erm(A) | - | 1..64500 | 64500 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T106947 WP_002360667.1 NZ_CP030046:c46712-46602 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
>T106947 NZ_CP030046:c46712-46602 [Enterococcus faecalis]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
Antitoxin
Download Length: 65 bp
>AT106947 NZ_CP030046:46497-46561 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|