Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 321703..321906 | Replicon | chromosome |
Accession | NZ_CP030045 | ||
Organism | Enterococcus faecalis strain C54 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | DOU32_RS01745 | Protein ID | WP_157734666.1 |
Coordinates | 321802..321906 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 321703..321767 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DOU32_RS01730 | 317321..319063 | + | 1743 | WP_161978239.1 | PTS transporter subunit EIIC | - |
DOU32_RS01735 | 319054..321087 | + | 2034 | WP_138818507.1 | transcription antiterminator | - |
DOU32_RS01740 | 321098..321532 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 321703..321767 | + | 65 | NuclAT_14 | - | Antitoxin |
DOU32_RS01745 | 321802..321906 | - | 105 | WP_157734666.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
DOU32_RS01750 | 322143..323915 | + | 1773 | WP_085345056.1 | PTS mannitol transporter subunit IICBA | - |
DOU32_RS01755 | 323930..324367 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
DOU32_RS01760 | 324382..325536 | + | 1155 | WP_085345055.1 | mannitol-1-phosphate 5-dehydrogenase | - |
DOU32_RS01765 | 325603..326718 | - | 1116 | WP_085345054.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 4014.85 Da Isoelectric Point: 6.4459
>T106921 WP_157734666.1 NZ_CP030045:c321906-321802 [Enterococcus faecalis]
VHHIYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
VHHIYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 105 bp
>T106921 NZ_CP030045:c321906-321802 [Enterococcus faecalis]
GTGCATCACATATACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTG
GTTGGAAAAACAGAACGAGGAATAA
GTGCATCACATATACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTG
GTTGGAAAAACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT106921 NZ_CP030045:321703-321767 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|