Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 43614..43856 | Replicon | plasmid pC25-1 |
Accession | NZ_CP030043 | ||
Organism | Enterococcus faecalis strain C25 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | DOU31_RS14625 | Protein ID | WP_002360667.1 |
Coordinates | 43614..43724 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 43765..43856 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DOU31_RS14585 | 39525..40145 | + | 621 | WP_161978277.1 | recombinase family protein | - |
DOU31_RS14590 | 40135..40449 | + | 315 | WP_002390465.1 | hypothetical protein | - |
DOU31_RS14595 | 40443..40667 | + | 225 | WP_002358271.1 | hypothetical protein | - |
DOU31_RS14600 | 40736..40936 | + | 201 | WP_002390466.1 | hypothetical protein | - |
DOU31_RS14605 | 40957..41259 | + | 303 | WP_128713120.1 | hypothetical protein | - |
DOU31_RS14610 | 41688..43016 | + | 1329 | WP_138807346.1 | Y-family DNA polymerase | - |
DOU31_RS14615 | 43013..43363 | + | 351 | WP_138807348.1 | UvaF | - |
DOU31_RS14625 | 43614..43724 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 43765..43856 | - | 92 | NuclAT_0 | - | Antitoxin |
- | 43765..43856 | - | 92 | NuclAT_0 | - | Antitoxin |
- | 43765..43856 | - | 92 | NuclAT_0 | - | Antitoxin |
- | 43765..43856 | - | 92 | NuclAT_0 | - | Antitoxin |
DOU31_RS14630 | 43965..44261 | + | 297 | WP_002360665.1 | replication control protein PrgN | - |
DOU31_RS14635 | 44515..45297 | + | 783 | WP_002360664.1 | ParA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | erm(A) / optrA / fexA | - | 1..45581 | 45581 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T106919 WP_002360667.1 NZ_CP030043:43614-43724 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
>T106919 NZ_CP030043:43614-43724 [Enterococcus faecalis]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
Antitoxin
Download Length: 92 bp
>AT106919 NZ_CP030043:c43856-43765 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|