Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 2515896..2516091 | Replicon | chromosome |
Accession | NZ_CP030042 | ||
Organism | Enterococcus faecalis strain C25 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | DOU31_RS15140 | Protein ID | WP_015543884.1 |
Coordinates | 2515896..2515991 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2516026..2516091 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DOU31_RS12660 | 2511073..2512188 | + | 1116 | WP_002397546.1 | FAD-binding oxidoreductase | - |
DOU31_RS12665 | 2512257..2513411 | - | 1155 | WP_002386082.1 | mannitol-1-phosphate 5-dehydrogenase | - |
DOU31_RS12670 | 2513426..2513863 | - | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
DOU31_RS12675 | 2513878..2515650 | - | 1773 | WP_002405272.1 | PTS mannitol transporter subunit IICBA | - |
DOU31_RS15140 | 2515896..2515991 | + | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2516026..2516091 | - | 66 | - | - | Antitoxin |
DOU31_RS12685 | 2516248..2516682 | - | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
DOU31_RS12690 | 2516693..2518726 | - | 2034 | WP_002397548.1 | transcription antiterminator | - |
DOU31_RS12695 | 2518717..2520465 | - | 1749 | WP_002397549.1 | PTS transporter subunit EIIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T106914 WP_015543884.1 NZ_CP030042:2515896-2515991 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T106914 NZ_CP030042:2515896-2515991 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCTATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCTATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 66 bp
>AT106914 NZ_CP030042:c2516091-2516026 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|