Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 25730..25994 | Replicon | plasmid p51008369SK1_B |
| Accession | NZ_CP029975 | ||
| Organism | Escherichia coli strain 51008369SK1 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | DNQ41_RS25460 | Protein ID | WP_001303307.1 |
| Coordinates | 25730..25882 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 25932..25994 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DNQ41_RS25435 | 21575..22237 | + | 663 | WP_000644794.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| DNQ41_RS25440 | 22335..22544 | + | 210 | WP_032178830.1 | hemolysin expression modulator Hha | - |
| DNQ41_RS25445 | 22876..23280 | - | 405 | WP_001175009.1 | IS200/IS605 family transposase | - |
| DNQ41_RS25450 | 23339..24565 | + | 1227 | WP_024186316.1 | transposase | - |
| DNQ41_RS27925 | 24610..24747 | + | 138 | WP_047088497.1 | hypothetical protein | - |
| DNQ41_RS25455 | 25407..25658 | + | 252 | WP_001291965.1 | hypothetical protein | - |
| DNQ41_RS25460 | 25730..25882 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| - | 25932..25994 | + | 63 | NuclAT_0 | - | Antitoxin |
| - | 25932..25994 | + | 63 | NuclAT_0 | - | Antitoxin |
| - | 25932..25994 | + | 63 | NuclAT_0 | - | Antitoxin |
| - | 25932..25994 | + | 63 | NuclAT_0 | - | Antitoxin |
| DNQ41_RS25465 | 26174..27382 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| DNQ41_RS25470 | 27401..28471 | + | 1071 | WP_000151576.1 | IncI1-type conjugal transfer protein TrbB | - |
| DNQ41_RS25475 | 28464..30755 | + | 2292 | WP_001289275.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA1 / ant(3'')-Ia / qacE / sul1 / blaTEM-30 / floR / sul2 | - | 1..113340 | 113340 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T106786 WP_001303307.1 NZ_CP029975:c25882-25730 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T106786 NZ_CP029975:c25882-25730 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT106786 NZ_CP029975:25932-25994 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|