Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1996449..1996631 | Replicon | chromosome |
| Accession | NZ_CP029685 | ||
| Organism | Staphylococcus aureus strain CMRSA-3 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | C7M54_RS10275 | Protein ID | WP_001801861.1 |
| Coordinates | 1996449..1996544 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1996572..1996631 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7M54_RS10225 | 1992109..1992735 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| C7M54_RS10230 | 1992776..1993120 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| C7M54_RS10235 | 1993218..1993769 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| C7M54_RS10240 | 1993987..1994628 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| C7M54_RS10245 | 1994742..1994927 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| C7M54_RS10250 | 1994929..1995105 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| C7M54_RS10255 | 1995116..1995499 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| C7M54_RS10265 | 1996103..1996246 | - | 144 | WP_001549059.1 | transposase | - |
| C7M54_RS10275 | 1996449..1996544 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1996572..1996631 | - | 60 | - | - | Antitoxin |
| C7M54_RS10280 | 1996667..1996768 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| C7M54_RS10285 | 1996746..1996922 | - | 177 | Protein_1936 | transposase | - |
| C7M54_RS10290 | 1997116..1997493 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1970411..2047712 | 77301 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T106376 WP_001801861.1 NZ_CP029685:1996449-1996544 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T106376 NZ_CP029685:1996449-1996544 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT106376 NZ_CP029685:c1996631-1996572 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|