Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2603193..2603377 | Replicon | chromosome |
Accession | NZ_CP029678 | ||
Organism | Staphylococcus aureus strain AR_0216 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | CSB72_RS14060 | Protein ID | WP_000482650.1 |
Coordinates | 2603270..2603377 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2603193..2603253 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSB72_RS14035 | 2598723..2598890 | - | 168 | WP_001790576.1 | hypothetical protein | - |
CSB72_RS14045 | 2599121..2600854 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
CSB72_RS14050 | 2600879..2602642 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
- | 2603193..2603253 | + | 61 | - | - | Antitoxin |
CSB72_RS14060 | 2603270..2603377 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
CSB72_RS14065 | 2603511..2603897 | - | 387 | WP_000779358.1 | flippase GtxA | - |
CSB72_RS14070 | 2604165..2605307 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
CSB72_RS14075 | 2605367..2606026 | + | 660 | WP_000831298.1 | membrane protein | - |
CSB72_RS14080 | 2606208..2607419 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
CSB72_RS14085 | 2607542..2608015 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T106301 WP_000482650.1 NZ_CP029678:c2603377-2603270 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T106301 NZ_CP029678:c2603377-2603270 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT106301 NZ_CP029678:2603193-2603253 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|