Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1831436..1831735 | Replicon | chromosome |
Accession | NZ_CP029669 | ||
Organism | Staphylococcus aureus strain AR_0223 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | CSB79_RS09755 | Protein ID | WP_011447039.1 |
Coordinates | 1831559..1831735 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1831436..1831491 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSB79_RS09720 | 1827186..1827278 | - | 93 | WP_001801779.1 | hypothetical protein | - |
CSB79_RS09725 | 1827374..1828573 | + | 1200 | WP_000286484.1 | NADH-dependent flavin oxidoreductase | - |
CSB79_RS09730 | 1828646..1829473 | + | 828 | WP_000136020.1 | alpha/beta hydrolase | - |
CSB79_RS09740 | 1830326..1831081 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
CSB79_RS09745 | 1831093..1831347 | - | 255 | WP_000611514.1 | phage holin | - |
CSB79_RS09750 | 1831399..1831506 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1831428..1831567 | + | 140 | NuclAT_0 | - | - |
- | 1831428..1831567 | + | 140 | NuclAT_0 | - | - |
- | 1831428..1831567 | + | 140 | NuclAT_0 | - | - |
- | 1831428..1831567 | + | 140 | NuclAT_0 | - | - |
- | 1831436..1831491 | + | 56 | - | - | Antitoxin |
CSB79_RS09755 | 1831559..1831735 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
CSB79_RS09760 | 1831885..1832181 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
CSB79_RS09765 | 1832239..1832526 | - | 288 | WP_001040261.1 | hypothetical protein | - |
CSB79_RS09770 | 1832573..1832725 | - | 153 | WP_001153681.1 | hypothetical protein | - |
CSB79_RS09775 | 1832715..1836500 | - | 3786 | WP_001644870.1 | phage minor structural protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | geh | 1830326..1880774 | 50448 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T106227 WP_011447039.1 NZ_CP029669:c1831735-1831559 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T106227 NZ_CP029669:c1831735-1831559 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT106227 NZ_CP029669:1831436-1831491 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|