Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 315100..315282 | Replicon | chromosome |
| Accession | NZ_CP029669 | ||
| Organism | Staphylococcus aureus strain AR_0223 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | CSB79_RS02005 | Protein ID | WP_001801861.1 |
| Coordinates | 315187..315282 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 315100..315159 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CSB79_RS01990 | 314238..314615 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| CSB79_RS01995 | 314809..314985 | + | 177 | Protein_329 | transposase | - |
| CSB79_RS02000 | 314963..315064 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 315100..315159 | + | 60 | - | - | Antitoxin |
| CSB79_RS02005 | 315187..315282 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| CSB79_RS02015 | 315485..315628 | + | 144 | WP_001549059.1 | transposase | - |
| CSB79_RS02025 | 316232..316615 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| CSB79_RS02030 | 316626..316802 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| CSB79_RS02035 | 316804..316989 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| CSB79_RS02040 | 317103..317744 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CSB79_RS02045 | 317962..318513 | - | 552 | WP_000414205.1 | hypothetical protein | - |
| CSB79_RS02050 | 318611..318955 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| CSB79_RS02055 | 318996..319622 | - | 627 | Protein_339 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hlgA / lukD | 282009..352722 | 70713 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T106224 WP_001801861.1 NZ_CP029669:c315282-315187 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T106224 NZ_CP029669:c315282-315187 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT106224 NZ_CP029669:315100-315159 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|