Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 925311..925493 | Replicon | chromosome |
Accession | NZ_CP029667 | ||
Organism | Staphylococcus aureus strain AR_0225 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CSB81_RS05475 | Protein ID | WP_001801861.1 |
Coordinates | 925398..925493 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 925311..925370 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSB81_RS05460 | 924449..924826 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
CSB81_RS05465 | 925020..925196 | + | 177 | Protein_956 | transposase | - |
CSB81_RS05470 | 925174..925275 | - | 102 | WP_001791893.1 | hypothetical protein | - |
- | 925311..925370 | + | 60 | - | - | Antitoxin |
CSB81_RS05475 | 925398..925493 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
CSB81_RS05485 | 925696..925839 | + | 144 | WP_001549059.1 | transposase | - |
CSB81_RS05495 | 926443..926826 | + | 384 | WP_000070811.1 | hypothetical protein | - |
CSB81_RS05500 | 926837..927013 | + | 177 | WP_000375476.1 | hypothetical protein | - |
CSB81_RS05505 | 927015..927200 | + | 186 | WP_000809857.1 | hypothetical protein | - |
CSB81_RS05510 | 927314..927955 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
CSB81_RS05515 | 928173..928724 | - | 552 | WP_000414205.1 | hypothetical protein | - |
CSB81_RS05520 | 928822..929166 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
CSB81_RS05525 | 929207..929833 | - | 627 | Protein_966 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | hlgA / lukD | 792389..962450 | 170061 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T106215 WP_001801861.1 NZ_CP029667:c925493-925398 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T106215 NZ_CP029667:c925493-925398 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT106215 NZ_CP029667:925311-925370 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|