Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2095049..2095348 | Replicon | chromosome |
| Accession | NZ_CP029657 | ||
| Organism | Staphylococcus aureus strain AR_0468 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | CSC53_RS11050 | Protein ID | WP_011447039.1 |
| Coordinates | 2095172..2095348 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2095049..2095104 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CSC53_RS11000 | 2090380..2090640 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| CSC53_RS11000 | 2090380..2090640 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| CSC53_RS11005 | 2090693..2091043 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| CSC53_RS11005 | 2090693..2091043 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| CSC53_RS11010 | 2091728..2092177 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| CSC53_RS11010 | 2091728..2092177 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| CSC53_RS11015 | 2092272..2092607 | - | 336 | Protein_2005 | SH3 domain-containing protein | - |
| CSC53_RS11015 | 2092272..2092607 | - | 336 | Protein_2005 | SH3 domain-containing protein | - |
| CSC53_RS11030 | 2093257..2093748 | - | 492 | WP_000919350.1 | staphylokinase | - |
| CSC53_RS11030 | 2093257..2093748 | - | 492 | WP_000919350.1 | staphylokinase | - |
| CSC53_RS11035 | 2093939..2094694 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| CSC53_RS11035 | 2093939..2094694 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| CSC53_RS11040 | 2094706..2094960 | - | 255 | WP_000611512.1 | phage holin | - |
| CSC53_RS11040 | 2094706..2094960 | - | 255 | WP_000611512.1 | phage holin | - |
| CSC53_RS11045 | 2095012..2095119 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| CSC53_RS11045 | 2095012..2095119 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2095041..2095180 | + | 140 | NuclAT_0 | - | - |
| - | 2095041..2095180 | + | 140 | NuclAT_0 | - | - |
| - | 2095041..2095180 | + | 140 | NuclAT_0 | - | - |
| - | 2095041..2095180 | + | 140 | NuclAT_0 | - | - |
| - | 2095041..2095180 | + | 140 | NuclAT_0 | - | - |
| - | 2095041..2095180 | + | 140 | NuclAT_0 | - | - |
| - | 2095041..2095180 | + | 140 | NuclAT_0 | - | - |
| - | 2095041..2095180 | + | 140 | NuclAT_0 | - | - |
| - | 2095049..2095104 | + | 56 | - | - | Antitoxin |
| CSC53_RS11050 | 2095172..2095348 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| CSC53_RS11050 | 2095172..2095348 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| CSC53_RS11055 | 2095498..2095794 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| CSC53_RS11055 | 2095498..2095794 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| CSC53_RS11060 | 2095852..2096139 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| CSC53_RS11060 | 2095852..2096139 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| CSC53_RS11065 | 2096186..2096338 | - | 153 | WP_031864465.1 | hypothetical protein | - |
| CSC53_RS11065 | 2096186..2096338 | - | 153 | WP_031864465.1 | hypothetical protein | - |
| CSC53_RS11070 | 2096328..2100113 | - | 3786 | WP_000582154.1 | hypothetical protein | - |
| CSC53_RS11070 | 2096328..2100113 | - | 3786 | WP_000582154.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2090693..2144212 | 53519 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T106132 WP_011447039.1 NZ_CP029657:c2095348-2095172 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T106132 NZ_CP029657:c2095348-2095172 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT106132 NZ_CP029657:2095049-2095104 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|