Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2730552..2730732 | Replicon | chromosome |
Accession | NZ_CP029649 | ||
Organism | Staphylococcus aureus strain AR_0472 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CSC57_RS14245 | Protein ID | WP_001801861.1 |
Coordinates | 2730637..2730732 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2730552..2730609 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSC57_RS14215 | 2726903..2728021 | + | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
CSC57_RS14220 | 2728669..2729085 | + | 417 | WP_020978241.1 | DUF1433 domain-containing protein | - |
CSC57_RS14225 | 2729322..2729669 | + | 348 | WP_001566695.1 | DUF1433 domain-containing protein | - |
CSC57_RS14230 | 2729691..2730065 | + | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
CSC57_RS14235 | 2730253..2730435 | + | 183 | Protein_2637 | transposase | - |
CSC57_RS14240 | 2730413..2730514 | - | 102 | WP_001791232.1 | hypothetical protein | - |
- | 2730552..2730609 | + | 58 | - | - | Antitoxin |
CSC57_RS14245 | 2730637..2730732 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
CSC57_RS14255 | 2731183..2731629 | + | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
CSC57_RS14260 | 2732314..2732697 | + | 384 | WP_000070811.1 | hypothetical protein | - |
CSC57_RS14265 | 2732708..2732884 | + | 177 | WP_000375476.1 | hypothetical protein | - |
CSC57_RS14275 | 2733255..2733812 | + | 558 | WP_000864139.1 | ImmA/IrrE family metallo-endopeptidase | - |
CSC57_RS14280 | 2734010..2734582 | - | 573 | WP_000414206.1 | hypothetical protein | - |
CSC57_RS14285 | 2734683..2735024 | - | 342 | WP_000627547.1 | DUF3969 family protein | - |
CSC57_RS14290 | 2735065..2735691 | - | 627 | WP_000669021.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk / hlgA / lukD | 2692694..2738249 | 45555 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T106079 WP_001801861.1 NZ_CP029649:c2730732-2730637 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T106079 NZ_CP029649:c2730732-2730637 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT106079 NZ_CP029649:2730552-2730609 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|