Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2536501..2536685 | Replicon | chromosome |
Accession | NZ_CP029627 | ||
Organism | Staphylococcus aureus strain MOK042 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | DLJ55_RS13370 | Protein ID | WP_000482647.1 |
Coordinates | 2536578..2536685 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2536501..2536561 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DLJ55_RS13345 | 2531955..2532122 | - | 168 | WP_001790576.1 | hypothetical protein | - |
DLJ55_RS13355 | 2532353..2534086 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
DLJ55_RS13360 | 2534111..2535874 | - | 1764 | WP_001064814.1 | ABC transporter ATP-binding protein/permease | - |
- | 2536501..2536561 | + | 61 | - | - | Antitoxin |
DLJ55_RS13370 | 2536578..2536685 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
DLJ55_RS13375 | 2536819..2537205 | - | 387 | WP_000779360.1 | flippase GtxA | - |
DLJ55_RS13380 | 2537463..2538605 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
DLJ55_RS13385 | 2538665..2539324 | + | 660 | WP_000831298.1 | membrane protein | - |
DLJ55_RS13390 | 2539506..2540717 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
DLJ55_RS13395 | 2540840..2541313 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sbi / hlgA / hlgA / hlgC / hlgB | 2512900..2539324 | 26424 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T106043 WP_000482647.1 NZ_CP029627:c2536685-2536578 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T106043 NZ_CP029627:c2536685-2536578 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT106043 NZ_CP029627:2536501-2536561 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|