Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 151188..151614 | Replicon | plasmid pDA33137-178 |
Accession | NZ_CP029580 | ||
Organism | Escherichia coli strain DA33137 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | DLJ64_RS28230 | Protein ID | WP_001312861.1 |
Coordinates | 151188..151346 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 151390..151614 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DLJ64_RS28185 | 146300..146527 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
DLJ64_RS28190 | 146615..147292 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
DLJ64_RS28195 | 147426..147809 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
DLJ64_RS28200 | 148140..148742 | + | 603 | WP_110074666.1 | transglycosylase SLT domain-containing protein | - |
DLJ64_RS28205 | 149039..149860 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
DLJ64_RS28210 | 149979..150266 | - | 288 | WP_000107535.1 | hypothetical protein | - |
DLJ64_RS28985 | 150291..150497 | - | 207 | WP_000275859.1 | hypothetical protein | - |
DLJ64_RS28230 | 151188..151346 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 151390..151614 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 151390..151614 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 151390..151614 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 151390..151614 | - | 225 | NuclAT_0 | - | Antitoxin |
DLJ64_RS28785 | 151426..151614 | + | 189 | WP_001299721.1 | hypothetical protein | - |
DLJ64_RS28235 | 151626..152345 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
DLJ64_RS28240 | 152342..152776 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
DLJ64_RS28245 | 152831..154789 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
DLJ64_RS28250 | 154855..155088 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
DLJ64_RS28255 | 155151..155690 | - | 540 | WP_000290841.1 | single-stranded DNA-binding protein | - |
DLJ64_RS28790 | 156333..156575 | - | 243 | WP_001617878.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | qacE / blaCTX-M-14 / aadA5 / sul1 / mph(A) / erm(B) / aac(3)-IId / blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / cmlA1 | senB | 1..178078 | 178078 | |
- | inside | Integron | - | senB | 27..178076 | 178049 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T105906 WP_001312861.1 NZ_CP029580:c151346-151188 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T105906 NZ_CP029580:c151346-151188 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT105906 NZ_CP029580:c151614-151390 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|