Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 54861..55130 | Replicon | plasmid pDA33135-70 |
| Accession | NZ_CP029578 | ||
| Organism | Escherichia coli strain DA33135 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | DLJ63_RS27470 | Protein ID | WP_001312861.1 |
| Coordinates | 54972..55130 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 54861..54926 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DLJ63_RS27435 | 49879..50328 | - | 450 | WP_110046579.1 | hypothetical protein | - |
| DLJ63_RS27445 | 50630..51157 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| DLJ63_RS27450 | 51215..51448 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| DLJ63_RS27455 | 51509..53473 | + | 1965 | WP_000117316.1 | ParB/RepB/Spo0J family partition protein | - |
| DLJ63_RS27460 | 53542..53976 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| DLJ63_RS27465 | 53973..54692 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 54704..54928 | + | 225 | NuclAT_0 | - | - |
| - | 54704..54928 | + | 225 | NuclAT_0 | - | - |
| - | 54704..54928 | + | 225 | NuclAT_0 | - | - |
| - | 54704..54928 | + | 225 | NuclAT_0 | - | - |
| DLJ63_RS27875 | 54713..54892 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 54861..54926 | + | 66 | - | - | Antitoxin |
| DLJ63_RS27470 | 54972..55130 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| DLJ63_RS28055 | 55368..55745 | - | 378 | Protein_69 | hypothetical protein | - |
| DLJ63_RS27490 | 56045..56341 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| DLJ63_RS27495 | 56452..57273 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| DLJ63_RS27500 | 57570..58172 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| DLJ63_RS27510 | 58495..58878 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
| DLJ63_RS27515 | 59072..59743 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| DLJ63_RS27520 | 59880..60107 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-14 | - | 1..70197 | 70197 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T105860 WP_001312861.1 NZ_CP029578:54972-55130 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T105860 NZ_CP029578:54972-55130 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT105860 NZ_CP029578:54861-54926 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|