Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 26880..27133 | Replicon | plasmid pDA33135-70 |
Accession | NZ_CP029578 | ||
Organism | Escherichia coli strain DA33135 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | DLJ63_RS27245 | Protein ID | WP_001312851.1 |
Coordinates | 26984..27133 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 26880..26939 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DLJ63_RS27200 | 22791..23351 | + | 561 | WP_000139321.1 | fertility inhibition protein FinO | - |
DLJ63_RS27205 | 23480..23692 | + | 213 | WP_001309245.1 | ANR family transcriptional regulator | - |
DLJ63_RS27210 | 23937..24398 | + | 462 | WP_001233838.1 | thermonuclease family protein | - |
DLJ63_RS27215 | 24444..24653 | + | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
DLJ63_RS27220 | 24691..24900 | + | 210 | Protein_26 | hypothetical protein | - |
DLJ63_RS27225 | 24964..25668 | + | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
DLJ63_RS27230 | 25723..26109 | + | 387 | Protein_28 | DUF2726 domain-containing protein | - |
DLJ63_RS27235 | 26264..26737 | + | 474 | WP_016240489.1 | hypothetical protein | - |
- | 26880..26939 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 26880..26939 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 26880..26939 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 26880..26939 | - | 60 | NuclAT_1 | - | Antitoxin |
DLJ63_RS27245 | 26984..27133 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
DLJ63_RS27250 | 27418..27666 | + | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
DLJ63_RS27260 | 27911..27985 | + | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
DLJ63_RS27265 | 27978..28835 | + | 858 | WP_162543890.1 | incFII family plasmid replication initiator RepA | - |
DLJ63_RS27275 | 29748..30017 | + | 270 | WP_012881119.1 | ABC transporter ATPase | - |
DLJ63_RS27280 | 30014..30295 | + | 282 | WP_012881118.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
DLJ63_RS27285 | 30341..31189 | + | 849 | WP_012881117.1 | 3'-5' exonuclease | - |
DLJ63_RS27290 | 31306..31788 | + | 483 | WP_001311056.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-14 | - | 1..70197 | 70197 | |
- | flank | IS/Tn | - | - | 24964..25668 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T105854 WP_001312851.1 NZ_CP029578:26984-27133 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T105854 NZ_CP029578:26984-27133 [Escherichia coli]
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT105854 NZ_CP029578:c26939-26880 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|