Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 121338..121592 | Replicon | plasmid pDA33133-157 |
Accession | NZ_CP029575 | ||
Organism | Escherichia coli strain DA33133 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | - |
Locus tag | DLJ62_RS25320 | Protein ID | WP_015387399.1 |
Coordinates | 121386..121592 (+) | Length | 69 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 121338..121399 (-) |
Genomic Context
Location: 116990..117202 (213 bp)
Type: Others
Protein ID: WP_005012601.1
Type: Others
Protein ID: WP_005012601.1
Location: 117647..118324 (678 bp)
Type: Others
Protein ID: WP_001339397.1
Type: Others
Protein ID: WP_001339397.1
Location: 118324..118671 (348 bp)
Type: Others
Protein ID: WP_000624622.1
Type: Others
Protein ID: WP_000624622.1
Location: 118691..120262 (1572 bp)
Type: Others
Protein ID: WP_023149734.1
Type: Others
Protein ID: WP_023149734.1
Location: 121017..121199 (183 bp)
Type: Others
Protein ID: WP_000968309.1
Type: Others
Protein ID: WP_000968309.1
Location: 121386..121592 (207 bp)
Type: Toxin
Protein ID: WP_015387399.1
Type: Toxin
Protein ID: WP_015387399.1
Location: 121876..122133 (258 bp)
Type: Others
Protein ID: WP_000083833.1
Type: Others
Protein ID: WP_000083833.1
Location: 122369..122443 (75 bp)
Type: Others
Protein ID: WP_032336874.1
Type: Others
Protein ID: WP_032336874.1
Location: 122436..122882 (447 bp)
Type: Others
Protein ID: Protein_150
Type: Others
Protein ID: Protein_150
Location: 124203..125423 (1221 bp)
Type: Others
Protein ID: WP_000410951.1
Type: Others
Protein ID: WP_000410951.1
Location: 125434..126345 (912 bp)
Type: Others
Protein ID: WP_000440183.1
Type: Others
Protein ID: WP_000440183.1
Location: 117503..117592 (90 bp)
Type: Others
Protein ID: Protein_141
Type: Others
Protein ID: Protein_141
Location: 120300..120916 (617 bp)
Type: Others
Protein ID: Protein_145
Type: Others
Protein ID: Protein_145
Location: 121338..121399 (62 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 121338..121399 (62 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 121338..121399 (62 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 121338..121399 (62 bp)
Type: Antitoxin
Protein ID: NuclAT_2
Type: Antitoxin
Protein ID: NuclAT_2
Location: 122828..123310 (483 bp)
Type: Others
Protein ID: Protein_151
Type: Others
Protein ID: Protein_151
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DLJ62_RS25270 | 116990..117202 | + | 213 | WP_005012601.1 | hypothetical protein | - |
DLJ62_RS25995 | 117503..117592 | - | 90 | Protein_141 | IS1 family transposase | - |
DLJ62_RS25285 | 117647..118324 | + | 678 | WP_001339397.1 | IS66 family insertion sequence hypothetical protein | - |
DLJ62_RS25290 | 118324..118671 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
DLJ62_RS25295 | 118691..120262 | + | 1572 | WP_023149734.1 | IS66 family transposase | - |
DLJ62_RS25300 | 120300..120916 | - | 617 | Protein_145 | IS1 family transposase | - |
DLJ62_RS25310 | 121017..121199 | + | 183 | WP_000968309.1 | hypothetical protein | - |
- | 121338..121399 | - | 62 | NuclAT_2 | - | Antitoxin |
- | 121338..121399 | - | 62 | NuclAT_2 | - | Antitoxin |
- | 121338..121399 | - | 62 | NuclAT_2 | - | Antitoxin |
- | 121338..121399 | - | 62 | NuclAT_2 | - | Antitoxin |
DLJ62_RS25320 | 121386..121592 | + | 207 | WP_015387399.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
DLJ62_RS25325 | 121876..122133 | + | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
DLJ62_RS25335 | 122369..122443 | + | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
DLJ62_RS25340 | 122436..122882 | + | 447 | Protein_150 | incFII family plasmid replication initiator RepA | - |
DLJ62_RS25345 | 122828..123310 | - | 483 | Protein_151 | VENN motif pre-toxin domain-containing protein | - |
DLJ62_RS25350 | 124203..125423 | + | 1221 | WP_000410951.1 | arginine deiminase | - |
DLJ62_RS25355 | 125434..126345 | + | 912 | WP_000440183.1 | carbamate kinase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | erm(B) / blaCTX-M-15 / aac(3)-IId / mph(A) / sul1 / qacE / aadA5 / dfrA17 / aac(6')-Ib-cr / blaOXA-1 | - | 1..156518 | 156518 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7720.23 Da Isoelectric Point: 9.3127
>T105823 WP_015387399.1 NZ_CP029575:121386-121592 [Escherichia coli]
MKYLNTTDCSLFLAGRSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFLAGRSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
>T105823 NZ_CP029575:121386-121592 [Escherichia coli]
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCCTTGCAGGGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAACTGAATATTCACAGGG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCCTTGCAGGGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAACTGAATATTCACAGGG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT105823 NZ_CP029575:c121399-121338 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Download structure file