Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 145694..145947 | Replicon | plasmid pKPC2_020079 |
Accession | NZ_CP029381 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | CLQ72_RS01270 | Protein ID | WP_001312851.1 |
Coordinates | 145798..145947 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 145694..145753 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CLQ72_RS01215 | 141017..141130 | + | 114 | Protein_216 | adenine-specific DNA-methyltransferase | - |
CLQ72_RS01220 | 141076..141462 | - | 387 | WP_109491564.1 | DDE-type integrase/transposase/recombinase | - |
CLQ72_RS01225 | 141407..141526 | + | 120 | Protein_218 | AraC family transcriptional regulator | - |
CLQ72_RS01230 | 141472..142176 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
CLQ72_RS01235 | 142240..142401 | + | 162 | Protein_220 | DNA helicase | - |
CLQ72_RS01240 | 142421..143167 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
CLQ72_RS01245 | 143222..143782 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
CLQ72_RS01250 | 143914..144114 | + | 201 | WP_015059022.1 | hypothetical protein | - |
CLQ72_RS01255 | 144500..145099 | + | 600 | WP_032083981.1 | hypothetical protein | - |
CLQ72_RS01260 | 145263..145493 | + | 231 | WP_001736714.1 | hypothetical protein | - |
CLQ72_RS01265 | 145516..145743 | - | 228 | Protein_226 | hypothetical protein | - |
- | 145694..145753 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 145694..145753 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 145694..145753 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 145694..145753 | - | 60 | NuclAT_1 | - | Antitoxin |
CLQ72_RS01270 | 145798..145947 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CLQ72_RS01275 | 146231..146479 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
CLQ72_RS01280 | 146480..146689 | - | 210 | WP_064765370.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaKPC-2 / blaSHV-12 | - | 1..146790 | 146790 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T105549 WP_001312851.1 NZ_CP029381:145798-145947 [Klebsiella pneumoniae subsp. pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T105549 NZ_CP029381:145798-145947 [Klebsiella pneumoniae subsp. pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT105549 NZ_CP029381:c145753-145694 [Klebsiella pneumoniae subsp. pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|