Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 2154896..2155117 Replicon chromosome
Accession NZ_CP029327
Organism Escherichia coli strain A37

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag AOY90_RS10385 Protein ID WP_000170963.1
Coordinates 2154896..2155003 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 2155051..2155117 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AOY90_RS10360 (2150740) 2150740..2151822 + 1083 WP_000804726.1 peptide chain release factor 1 -
AOY90_RS10365 (2151822) 2151822..2152655 + 834 WP_000456476.1 peptide chain release factor N(5)-glutamine methyltransferase -
AOY90_RS10370 (2152652) 2152652..2153044 + 393 WP_000200375.1 invasion regulator SirB2 -
AOY90_RS10375 (2153048) 2153048..2153857 + 810 WP_001257054.1 invasion regulator SirB1 -
AOY90_RS10380 (2153893) 2153893..2154747 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AOY90_RS10385 (2154896) 2154896..2155003 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2155053) 2155053..2155116 + 64 NuclAT_16 - -
- (2155053) 2155053..2155116 + 64 NuclAT_16 - -
- (2155053) 2155053..2155116 + 64 NuclAT_16 - -
- (2155053) 2155053..2155116 + 64 NuclAT_16 - -
- (2155053) 2155053..2155116 + 64 NuclAT_19 - -
- (2155053) 2155053..2155116 + 64 NuclAT_19 - -
- (2155053) 2155053..2155116 + 64 NuclAT_19 - -
- (2155053) 2155053..2155116 + 64 NuclAT_19 - -
- (2155053) 2155053..2155116 + 64 NuclAT_22 - -
- (2155053) 2155053..2155116 + 64 NuclAT_22 - -
- (2155053) 2155053..2155116 + 64 NuclAT_22 - -
- (2155053) 2155053..2155116 + 64 NuclAT_22 - -
- (2155053) 2155053..2155116 + 64 NuclAT_25 - -
- (2155053) 2155053..2155116 + 64 NuclAT_25 - -
- (2155053) 2155053..2155116 + 64 NuclAT_25 - -
- (2155053) 2155053..2155116 + 64 NuclAT_25 - -
- (2155053) 2155053..2155116 + 64 NuclAT_26 - -
- (2155053) 2155053..2155116 + 64 NuclAT_26 - -
- (2155053) 2155053..2155116 + 64 NuclAT_26 - -
- (2155053) 2155053..2155116 + 64 NuclAT_26 - -
- (2155053) 2155053..2155116 + 64 NuclAT_29 - -
- (2155053) 2155053..2155116 + 64 NuclAT_29 - -
- (2155053) 2155053..2155116 + 64 NuclAT_29 - -
- (2155053) 2155053..2155116 + 64 NuclAT_29 - -
- (2155051) 2155051..2155117 + 67 NuclAT_10 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_10 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_10 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_10 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_5 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_5 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_5 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_5 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_6 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_6 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_6 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_6 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_7 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_7 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_7 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_7 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_8 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_8 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_8 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_8 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_9 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_9 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_9 - Antitoxin
- (2155051) 2155051..2155117 + 67 NuclAT_9 - Antitoxin
AOY90_RS10390 (2155408) 2155408..2156508 - 1101 WP_097752081.1 sodium-potassium/proton antiporter ChaA -
AOY90_RS10395 (2156778) 2156778..2157008 + 231 WP_001146444.1 putative cation transport regulator ChaB -
AOY90_RS10400 (2157166) 2157166..2157861 + 696 WP_097752082.1 glutathione-specific gamma-glutamylcyclotransferase -
AOY90_RS10405 (2157905) 2157905..2158258 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
AOY90_RS10410 (2158443) 2158443..2159837 + 1395 WP_097752083.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T105415 WP_000170963.1 NZ_CP029327:c2155003-2154896 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T105415 NZ_CP029327:c2155003-2154896 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTTGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT105415 NZ_CP029327:2155051-2155117 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGGTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References